Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.251 0.000

Gene RIF (1)

PMID Text
21965664 the human Shu complex (hSWS1.SWSAP1) has an evolutionarily conserved function in homologous recombination

AA Sequence

MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPP      1 - 70
STRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVA     71 - 140
LQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPW    141 - 210
PTQAGDPSSGKGSSSGGQP                                                       211 - 229
//

Text Mined References (5)

PMID Year Title
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.