Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.2e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.251 2.2e-04

Synonym

Accession Q6NVH7 Q8NAM1
Symbols SWS1AP1
C19orf39
ZSWIM7AP1

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPP      1 - 70
STRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVA     71 - 140
LQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPW    141 - 210
PTQAGDPSSGKGSSSGGQP                                                       211 - 229
//

Text Mined References (5)

PMID Year Title