Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.94
PubTator Score 3.62

Knowledge Summary

Patent (1,136)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 2.4e-04
atypical teratoid/rhabdoid tumor -1.100 3.7e-05
posterior fossa group A ependymoma -1.300 1.3e-09
primitive neuroectodermal tumor 1.100 2.2e-03

AA Sequence

MSDERRLPGSAVGWLVCGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVPIATYSVVQLR      1 - 70
RQRPDFEWNEGLCKVFVSTFYTLTLATCFSVTSLSYHRMWMVCWPVNYRLSNAKKQAVHTVMGIWMVSFI     71 - 140
LSALPAVGWHDTSERFYTHGCRFIVAEIGLGFGVCFLLLVGGSVAMGVICTAIALFQTLAVQVGRQADRR    141 - 210
AFTVPTIVVEDAQGKRRSSIDGSEPAKTSLQTTGLVTTIVFIYDCLMGFPVLVVSFSSLRADASAPWMAL    211 - 280
CVLWCSVAQALLLPVFLWACDRYRADLKAVREKCMALMANDEESDDETSLEGGISPDLVLERSLDYGYGG    281 - 350
DFVALDRMAKYEISALEGGLPQLYPLRPLQEDKMQYLQVPPTRRFSHDDADVWAAVPLPAFLPRWGSGED    351 - 420
LAALAHLVLPAGPERRRASLLAFAEDAPPSRARRRSAESLLSLRPSALDSGPRGARDSPPGSPRRRPGPG    421 - 490
PRSASASLLPDAFALTAFECEPQALRRPPGPFPAAPAAPDGADPGEAPTPPSSAQRSPGPRPSAHSHAGS    491 - 560
LRPGLSASWGEPGGLRAAGGGGSTSSFLSSPSESSGYATLHSDSLGSAS                         561 - 609
//

Text Mined References (11)

PMID Year Title