Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 3.62

Knowledge Summary

Patent (1,136)

Expression

  Differential Expression (4)

AA Sequence

MSDERRLPGSAVGWLVCGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVPIATYSVVQLR      1 - 70
RQRPDFEWNEGLCKVFVSTFYTLTLATCFSVTSLSYHRMWMVCWPVNYRLSNAKKQAVHTVMGIWMVSFI     71 - 140
LSALPAVGWHDTSERFYTHGCRFIVAEIGLGFGVCFLLLVGGSVAMGVICTAIALFQTLAVQVGRQADRR    141 - 210
AFTVPTIVVEDAQGKRRSSIDGSEPAKTSLQTTGLVTTIVFIYDCLMGFPVLVVSFSSLRADASAPWMAL    211 - 280
CVLWCSVAQALLLPVFLWACDRYRADLKAVREKCMALMANDEESDDETSLEGGISPDLVLERSLDYGYGG    281 - 350
DFVALDRMAKYEISALEGGLPQLYPLRPLQEDKMQYLQVPPTRRFSHDDADVWAAVPLPAFLPRWGSGED    351 - 420
LAALAHLVLPAGPERRRASLLAFAEDAPPSRARRRSAESLLSLRPSALDSGPRGARDSPPGSPRRRPGPG    421 - 490
PRSASASLLPDAFALTAFECEPQALRRPPGPFPAAPAAPDGADPGEAPTPPSSAQRSPGPRPSAHSHAGS    491 - 560
LRPGLSASWGEPGGLRAAGGGGSTSSFLSSPSESSGYATLHSDSLGSAS                         561 - 609
//

Text Mined References (7)

PMID Year Title
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.