Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.11
PubTator Score 3.62

Knowledge Summary

Patent (1,136)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.33091854856246E-9
atypical teratoid/rhabdoid tumor 1095 3.65499081089254E-5
adult high grade glioma 2148 2.38257970912804E-4
primitive neuroectodermal tumor 3031 0.00217464519608099

Expression

  Differential Expression (4)

Synonym

Accession Q6NV75 Q5TGR5 Q6AHW8 Q86SP8
Symbols PGR1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available
Steve Finkbeiner Neuron specific phenotypes being screened

AA Sequence

MSDERRLPGSAVGWLVCGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVPIATYSVVQLR      1 - 70
RQRPDFEWNEGLCKVFVSTFYTLTLATCFSVTSLSYHRMWMVCWPVNYRLSNAKKQAVHTVMGIWMVSFI     71 - 140
LSALPAVGWHDTSERFYTHGCRFIVAEIGLGFGVCFLLLVGGSVAMGVICTAIALFQTLAVQVGRQADRR    141 - 210
AFTVPTIVVEDAQGKRRSSIDGSEPAKTSLQTTGLVTTIVFIYDCLMGFPVLVVSFSSLRADASAPWMAL    211 - 280
CVLWCSVAQALLLPVFLWACDRYRADLKAVREKCMALMANDEESDDETSLEGGISPDLVLERSLDYGYGG    281 - 350
DFVALDRMAKYEISALEGGLPQLYPLRPLQEDKMQYLQVPPTRRFSHDDADVWAAVPLPAFLPRWGSGED    351 - 420
LAALAHLVLPAGPERRRASLLAFAEDAPPSRARRRSAESLLSLRPSALDSGPRGARDSPPGSPRRRPGPG    421 - 490
PRSASASLLPDAFALTAFECEPQALRRPPGPFPAAPAAPDGADPGEAPTPPSSAQRSPGPRPSAHSHAGS    491 - 560
LRPGLSASWGEPGGLRAAGGGGSTSSFLSSPSESSGYATLHSDSLGSAS                         561 - 609
//

Text Mined References (7)

PMID Year Title
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.