Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.600 2.4e-03
atypical teratoid / rhabdoid tumor -3.700 1.9e-05
ductal carcinoma in situ 1.300 1.4e-03
ependymoma -3.400 5.0e-04
glioblastoma -2.600 7.2e-04
group 4 medulloblastoma -2.900 9.8e-03
lung adenocarcinoma -1.800 1.0e-11
medulloblastoma, large-cell -4.900 4.2e-04
nasopharyngeal carcinoma -2.200 1.6e-07
non-small cell lung cancer -2.155 2.8e-17
oligodendroglioma -2.300 1.0e-02
ovarian cancer -1.800 1.2e-06
pituitary cancer -1.300 3.6e-04
primitive neuroectodermal tumor -3.700 6.0e-04
psoriasis -1.100 2.4e-08
tuberculosis and treatment for 3 months -1.300 5.8e-05

Synonym

Accession Q6NV74
Symbols C2orf55

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MISTRVMDIKLREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGP      1 - 70
VGYDSEDELEESRGTLGSRALSHDSIFIPESGQDATRPVRVFSQENVCDRIKALQLKIQCNVKMGPPPPP     71 - 140
GGLPAKRGEDAGMSSEDDGLPRSPPEMSLLHDVGPGTTIKVSVVSPDHVSDSTVSARISDNSLAPVADFS    141 - 210
YPAESSSCLDNSAAKHKLQVKPRNQRSSKMRRLSSRAQSESLSDLTCTPEEEENEEKPLLEVSPEERPSS    211 - 280
GQQDVAPDRGPEPGPPAPLPPPGGARARRARLQHSSALTASVEEGGVPGEDPSSRPATPELAEPESAPTL    281 - 350
RVEPPSPPEGPPNPGPDGGKQDGEAPPAGPCAPATDKAEEVVCAPEDVASPFPTAIPEGDTTPPETDPAA    351 - 420
TSEAPSARDGPERSVPKEAEPTPPVLPDEEKGPPGPAPEPEREAETEPERGAGTEPERIGTEPSTAPAPS    421 - 490
PPAPKSCLKHRPAAASEGPAASPPLAAAESPPVEPGPGSLDAEAAAPERPKAERAEAPPAGAERAAPERK    491 - 560
AERGGAELRGAKKFSVSSCRARPRPGVSRPLERASGRLPLARSGPVWRSEAALDDLQGLPEPQHAKPGPR    561 - 630
KLAERGPQDSGDRAASPAGPRKSPQEAAAAPGTREPCPAAQEPAPSEDRNPFPVKLRSTSLSLKYRDGAS    631 - 700
QEVKGVKRYSAEVRLERSLTVLPKEEKCPLGTAPALRGTRAPSDQGKGKARPPEPLSSKPPLPRKPLLQS    701 - 770
FTLPHQPAPPDAGPGEREPRKEPRTAEKRPLRRGAEKSLPPAATGPGADGQPAPPWITVTRQKRRGTLDQ    771 - 840
PPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADFVRSKSFLITPVKPAVDRKQGAKLNFKEGLQRGIS    841 - 910
LSHQNLAQSAVMMEKELHQLKRASYASTDQPSWMELARKKSQAWSDMPQIIK                      911 - 962
//

Text Mined References (6)

PMID Year Title