Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.08275666020099E-17
non-small cell lung cancer 2798 2.75197757993719E-17
lung adenocarcinoma 2714 1.01729124461113E-11
psoriasis 6685 2.35975924515362E-8
nasopharyngeal carcinoma 1056 1.59745882452867E-7
medulloblastoma 1524 2.29765384417984E-7
ovarian cancer 8492 2.1292231222782E-6
atypical teratoid / rhabdoid tumor 4369 1.86583207251451E-5
tuberculosis and treatment for 3 months 327 5.81336258427177E-5
pituitary cancer 1972 3.58152942258985E-4
medulloblastoma, large-cell 6234 4.19393640646885E-4
ependymoma 2514 5.0388514277701E-4
primitive neuroectodermal tumor 3031 6.017291479842E-4
glioblastoma 5572 7.23264167236925E-4
ductal carcinoma in situ 1745 0.00140683788137821
astrocytic glioma 2241 0.00237849231526629
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.600 0.002
ependymoma -3.400 0.001
oligodendroglioma -2.600 0.000
glioblastoma -2.600 0.001
medulloblastoma -4.300 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -4.900 0.000
primitive neuroectodermal tumor -3.700 0.001
tuberculosis and treatment for 3 months -1.300 0.000
non-small cell lung cancer -2.155 0.000
lung adenocarcinoma -1.800 0.000
nasopharyngeal carcinoma -2.200 0.000
psoriasis -1.100 0.000
ductal carcinoma in situ 1.300 0.001
ovarian cancer 2.200 0.000
pituitary cancer -1.300 0.000

Synonym

Accession Q6NV74
Symbols C2orf55

Gene

  Ortholog (7)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MISTRVMDIKLREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGP      1 - 70
VGYDSEDELEESRGTLGSRALSHDSIFIPESGQDATRPVRVFSQENVCDRIKALQLKIQCNVKMGPPPPP     71 - 140
GGLPAKRGEDAGMSSEDDGLPRSPPEMSLLHDVGPGTTIKVSVVSPDHVSDSTVSARISDNSLAPVADFS    141 - 210
YPAESSSCLDNSAAKHKLQVKPRNQRSSKMRRLSSRAQSESLSDLTCTPEEEENEEKPLLEVSPEERPSS    211 - 280
GQQDVAPDRGPEPGPPAPLPPPGGARARRARLQHSSALTASVEEGGVPGEDPSSRPATPELAEPESAPTL    281 - 350
RVEPPSPPEGPPNPGPDGGKQDGEAPPAGPCAPATDKAEEVVCAPEDVASPFPTAIPEGDTTPPETDPAA    351 - 420
TSEAPSARDGPERSVPKEAEPTPPVLPDEEKGPPGPAPEPEREAETEPERGAGTEPERIGTEPSTAPAPS    421 - 490
PPAPKSCLKHRPAAASEGPAASPPLAAAESPPVEPGPGSLDAEAAAPERPKAERAEAPPAGAERAAPERK    491 - 560
AERGGAELRGAKKFSVSSCRARPRPGVSRPLERASGRLPLARSGPVWRSEAALDDLQGLPEPQHAKPGPR    561 - 630
KLAERGPQDSGDRAASPAGPRKSPQEAAAAPGTREPCPAAQEPAPSEDRNPFPVKLRSTSLSLKYRDGAS    631 - 700
QEVKGVKRYSAEVRLERSLTVLPKEEKCPLGTAPALRGTRAPSDQGKGKARPPEPLSSKPPLPRKPLLQS    701 - 770
FTLPHQPAPPDAGPGEREPRKEPRTAEKRPLRRGAEKSLPPAATGPGADGQPAPPWITVTRQKRRGTLDQ    771 - 840
PPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADFVRSKSFLITPVKPAVDRKQGAKLNFKEGLQRGIS    841 - 910
LSHQNLAQSAVMMEKELHQLKRASYASTDQPSWMELARKKSQAWSDMPQIIK                      911 - 962
//

Text Mined References (6)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.