Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 2.6e-06
osteosarcoma 7950 1.2e-05

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.100 2.6e-06
osteosarcoma -1.662 1.2e-05

Gene RIF (1)

AA Sequence

MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADG      1 - 70
LCTPLVGYEADRAASCCARYGPRKAWHLVGTVCVLLSFPFIFSPCLGCGAATPEWAALLYYGPFIVIFQF     71 - 140
GWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLG    141 - 210
GQDVPVFRNLSLLVVGVGAVFSLLFHLGTRERRRPHAEEPGEHTPLLAPATAQPLLLWKHWLREPAFYQV    211 - 280
GILYMTTRLIVNLSQTYMAMYLTYSLHLPKKFIATIPLVMYLSGFLSSFLMKPINKCIGRNMTYFSGLLV    281 - 350
ILAFAAWVALAEGLGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFLDKVANGLAV    351 - 420
MAIQSLHPCPSELCCRACVSFYHWAMVAVTGGVGVAAALCLCSLLLWPTRLRRWDRDARP              421 - 480
//

Text Mined References (7)

PMID Year Title