Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.23
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 1.500 0.000
glioblastoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
lung cancer 1.400 0.004
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.200 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q6NUS6 A6NIC8 B0QZ90 B4DR81 Q6P7P3 Q6UW27 Q6ZQQ0 Q8N7K1 Q8NBQ0 Q96GF7 Q9Y3U1
Symbols OFD4
TECT3
JBTS18
C10orf61

Gene

Gene RIF (2)

PMID Text
22883145 TCTN3 mutations cause Mohr-Majewski syndrome.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRTPQLALLQVFFLVFPDGVRPQPSSSPSGAVPTSLELQRGTDGGTLQSPSEATATRPAVPGLPTVVPTL      1 - 70
VTPSAPGNRTVDLFPVLPICVCDLTPGACDINCCCDRDCYLLHPRTVFSFCLPGSVRSSSWVCVDNSVIF     71 - 140
RSNSPFPSRVFMDSNGIRQFCVHVNNSNLNYFQKLQKVNATNFQALAAEFGGESFTSTFQTQSPPSFYRA    141 - 210
GDPILTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLASSCTLDSALNAASYYNF    211 - 280
TVLKVPRSMTDPQNMEFQVPVILTSQANAPLLAGNTCQNVVSQVTYEIETNGTFGIQKVSVSLGQTNLTV    281 - 350
EPGASLQQHFILRFRAFQQSTAASLTSPRSGNPGYIVGKPLLALTDDISYSMTLLQSQGNGSCSVKRHEV    351 - 420
QFGVNAISGCKLRLKKADCSHLQQEIYQTLHGRPRPEYVAIFGNADPAQKGGWTRILNRHCSISAINCTS    421 - 490
CCLIPVSLEIQVLWAYVGLLSNPQAHVSGVRFLYQCQSIQDSQQVTEVSLTTLVNFVDITQKPQPPRGQP    491 - 560
KMDWKWPFDFFPFKVAFSRGVFSQKCSVSPILILCLLLLGVLNLETM                           561 - 607
//

Text Mined References (13)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22883145 2012 TCTN3 mutations cause Mohr-Majewski syndrome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17464193 2007 Identification of novel regulators of apoptosis using a high-throughput cell-based screen.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16357211 2006 Tectonic, a novel regulator of the Hedgehog pathway required for both activation and inhibition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...