Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.99
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 4.9e-06
glioblastoma 5792 6.2e-05
psoriasis 6694 9.1e-05
osteosarcoma 7950 8.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Emery-Dreifuss muscular dystrophy 23 4.303 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.9e-06
glioblastoma 1.200 6.2e-05
osteosarcoma -1.077 8.2e-03
psoriasis -1.900 9.1e-05

 GO Process (1)

Gene RIF (1)

AA Sequence

MATKTAGVGRWEVVKKGRRPGVGAGAGGRGGGRNRRALGEANGVWKYDLTPAIQTTSTLYERGFENIMKR      1 - 70
QNKEQVPPPAVEPKKPGNKKQPKKVATPPNQNQKQGRFRSLEEALKALDVADLQKELDKSQSVFSGNPSI     71 - 140
WLKDLASYLNYKLQAPLSEPTLSQHTHDYPYSLVSRELRGIIRGLLAKAAGSLELFFDHCLFTMLQELDK    141 - 210
TPGESLHGYRICIQAILQDKPKIATANLGKFLELLRSHQSRPAKCLTIMWALGQAGFANLTEGLKVWLGI    211 - 280
MLPVLGIKSLSPFAITYLDRLLLMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLTPSLQEQLCQLYPRLK    281 - 350
VLAFGAKPDSTLHTYFPSFLSRATPSCPPEMKKELLSSLTECLTVDPLSASVWRQLYPKHLSQSSLLLEH    351 - 420
LLSSWEQIPKKVQKSLQETIQSLKLTNQELLRKGSSNNQDVVTCDMACKGLLQQVQGPRLPWTRLLLLLL    421 - 490
VFAVGFLCHDLRSHSSFQASLTGRLLRSSGFLPASQQACAKLYSYSLQGYSWLGETLPLWGSHLLTVVRP    491 - 560
SLQLAWAHTNATVSFLSAHCASHLAWFGDSLTSLSQRLQIQLPDSVNQLLRYLRELPLLFHQNVLLPLWH    561 - 630
LLLEALAWAQEHCHEACRGEVTWDCMKTQLSEAVHWTWLCLQDITVAFLDWALALISQQ               631 - 689
//

Text Mined References (12)

PMID Year Title