Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
R01 Count 4
Funding $235,585.4
PubMed Score 17.37
PubTator Score 15.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.266 0.000
ovarian cancer 1.700 0.000

Gene RIF (8)

PMID Text
25304616 Results suggest that high RAD50 interactor 1 (RINT1) expression may represent a risk factor for low-grade gliomas (LGGs)-related seizures.
25050558 Results identified RINT1 as a putative breast cancer predisposition gene that also seems to be associated with risk for a spectrum of other cancers similar to those that have previously been described for Lynch syndrome.
23885118 RINT-1 is also required for endosome-to-trans-Golgi network trafficking.
23074196 RINT1 was validated as a novel glioblastoma oncogene
19369418 Results together suggest that NAG links between p31 and ZW10-RINT-1 and is involved in Golgi-to-ER transport.
17699596 Rab6 regulates distinct Golgi trafficking pathways involving two separate protein complexes: ZW10/RINT-1 and COG.
17470549 These findings suggest that RINT-1 serves as a novel tumor suppressor essential for maintaining the dynamic integrity of the Golgi apparatus and the centrosome, a prerequisite to their proper coordination during cell division.
16571679 RINT-1 coordinates the localization and function of ZW10 by serving as a link between ZW10 and the SNARE complex comprising syntaxin 18.

AA Sequence

MLPAGEIGASPAAPCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKS      1 - 70
LKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFSAINSHLLTAQP     71 - 140
WMDDLGTMISQIEEIERHLAYLKWISQIEELSDNIQQYLMTNNVPEAASTLVSMAELDIKLQESSCTHLL    141 - 210
GFMRATVKFWHKILKDKLTSDFEEILAQLHWPFIAPPQSQTVGLSRPASAPEIYSYLETLFCQLLKLQTS    211 - 280
DELLTEPKQLPEKYSLPASPSVILPIQVMLTPLQKRFRYHFRGNRQTNVLSKPEWYLAQVLMWIGNHTEF    281 - 350
LDEKIQPILDKVGSLVNARLEFSRGLMMLVLEKLATDIPCLLYDDNLFCHLVDEVLLFERELHSVHGYPG    351 - 420
TFASCMHILSEETCFQRWLTVERKFALQKMDSMLSSEAAWVSQYKDITDVDEMKVPDCAETFMTLLLVIT    421 - 490
DRYKNLPTASRKLQFLELQKDLVDDFRIRLTQVMKEETRASLGFRYCAILNAVNYISTVLADWADNVFFL    491 - 560
QLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLERLKHDMLTRQVDHVFREVKDAAKLYKKERW    561 - 630
LSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGG    631 - 700
AAQLQFDMTRNLFPLFSHYCKRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIY    701 - 770
KLAQQDVEILLNLRTNWPNTGK                                                    771 - 792
//

Text Mined References (26)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25304616 2015 Expression of RINT1 predicts seizure occurrence and outcomes in patients with low-grade gliomas.
25050558 2014 Rare mutations in RINT1 predispose carriers to breast and Lynch syndrome-spectrum cancers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
23885118 2013 A new role for RINT-1 in SNARE complex assembly at the trans-Golgi network in coordination with the COG complex.
23074196 2012 Integrative functional genomics identifies RINT1 as a novel GBM oncogene.
21269460 2011 Initial characterization of the human central proteome.
More...