Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.55
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -4.300 1.4e-05
astrocytic glioma -3.000 1.6e-03
Astrocytoma, Pilocytic -1.100 1.5e-03
atypical teratoid / rhabdoid tumor -4.900 9.8e-10
Breast cancer -1.100 1.3e-02
ependymoma -2.400 6.1e-03
glioblastoma -1.100 1.0e-05
group 3 medulloblastoma -4.700 3.1e-04
lung adenocarcinoma -1.200 1.8e-08
lung cancer -1.100 2.0e-02
malignant mesothelioma -1.200 4.1e-04
medulloblastoma, large-cell -4.900 3.7e-04
oligodendroglioma -3.000 8.9e-03
Pick disease -1.400 4.7e-03
pituitary cancer 1.100 3.1e-02
primitive neuroectodermal tumor -4.700 4.6e-05

Synonym

Accession Q6NUP7 Q9BUF8 Q9HCF0
Symbols PP4R4
CFAP14
KIAA1622

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQ      1 - 70
GTSVIANLPFLMRQNPTETLRRVLPKVREALHVAGVEMQLTAAMSFLTILQDESVSIHAYTHSFLQVILL     71 - 140
HLEHRDTGVSNAWLETLLSVIEVLPKETLRHEILNPLVSKAQLSQTVQSRLVSCKILGKLTNKFDAHTIK    141 - 210
REILPLVKSLCQDVEYEVRSCMCRQLENIAQGIGTELTKSVVLPELIELSRDEGSSVRLAAFETLVNLLD    211 - 280
IFDTDDRSQTILPLVKSFCEKSFKADESILISLSFHLGKLCHGLYGIFTPDQHLRFLEFYKKLCTLGLQQ    281 - 350
ENGHNENQIPPQILEQEKKYISVRKNCAYNFPAMIVFVDPKNFHMELYSTFFCLCHDPEVPVRYTIAICF    351 - 420
YEVSKLLNSGVYLIHKELITLLQDESLEVLDALIDHLPEILELMSTGGESSVQENKLSSLPDLIPALTAA    421 - 490
EQRAAASLKWRTHEKLLQKYACLPHVISSDQIYYRFLQRMFTIMMTNNVLPVQKAASRTLCIFLRYNRKQ    491 - 560
EQRHEVIQKLIEQLGQGKSYWNRLRFLDTCEFIIEIFSKSFFCKYFFLPAIELTHDPVANVRMKLCYLLP    561 - 630
KVKSTLKIPADKHLLQQLEMCVRKLLCQEKDKDVLAIVKRTVLELDRMEMSMDAFQKKFYEKDLLDQEKE    631 - 700
REELLLLEMEQLEKEKQQNDGRPMSDKMFEKKRRDTKTPTQSLPKNIPISVPGPSSVTPSTSKEIKKSKL    701 - 770
IRSQSFNNQAFHAKYGNLEKCASKSSTTGYTTSVSGLGKTSVLSLADDSFRTRNASSVPSSFSPNTPLPS    771 - 840
TSRGTGNSVDPKSSGSKDTQPRKATLKSRKSNP                                         841 - 873
//

Text Mined References (8)

PMID Year Title