Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.55
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytoma -3.100 0.000
ependymoma -2.400 0.006
oligodendroglioma -3.400 0.000
glioblastoma -4.800 0.000
medulloblastoma -5.600 0.000
atypical teratoid / rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -4.900 0.000
primitive neuroectodermal tumor -4.700 0.000
lung cancer -3.400 0.000
lung adenocarcinoma -1.200 0.000
adult high grade glioma -4.300 0.000
pilocytic astrocytoma -3.600 0.000
Pick disease -1.400 0.005
Breast cancer -1.100 0.013
pituitary cancer 2.300 0.000

Gene RIF (1)

PMID Text
18715871 PP4R4 forms a novel cytosolic complex with PP4c, independent from the complexes containing PP4R1, PP4R2.PP4R3, and alpha4, and the regulatory subunits of PP4c have evolved different modes of interaction with the catalytic subunit

AA Sequence

MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQ      1 - 70
GTSVIANLPFLMRQNPTETLRRVLPKVREALHVAGVEMQLTAAMSFLTILQDESVSIHAYTHSFLQVILL     71 - 140
HLEHRDTGVSNAWLETLLSVIEVLPKETLRHEILNPLVSKAQLSQTVQSRLVSCKILGKLTNKFDAHTIK    141 - 210
REILPLVKSLCQDVEYEVRSCMCRQLENIAQGIGTELTKSVVLPELIELSRDEGSSVRLAAFETLVNLLD    211 - 280
IFDTDDRSQTILPLVKSFCEKSFKADESILISLSFHLGKLCHGLYGIFTPDQHLRFLEFYKKLCTLGLQQ    281 - 350
ENGHNENQIPPQILEQEKKYISVRKNCAYNFPAMIVFVDPKNFHMELYSTFFCLCHDPEVPVRYTIAICF    351 - 420
YEVSKLLNSGVYLIHKELITLLQDESLEVLDALIDHLPEILELMSTGGESSVQENKLSSLPDLIPALTAA    421 - 490
EQRAAASLKWRTHEKLLQKYACLPHVISSDQIYYRFLQRMFTIMMTNNVLPVQKAASRTLCIFLRYNRKQ    491 - 560
EQRHEVIQKLIEQLGQGKSYWNRLRFLDTCEFIIEIFSKSFFCKYFFLPAIELTHDPVANVRMKLCYLLP    561 - 630
KVKSTLKIPADKHLLQQLEMCVRKLLCQEKDKDVLAIVKRTVLELDRMEMSMDAFQKKFYEKDLLDQEKE    631 - 700
REELLLLEMEQLEKEKQQNDGRPMSDKMFEKKRRDTKTPTQSLPKNIPISVPGPSSVTPSTSKEIKKSKL    701 - 770
IRSQSFNNQAFHAKYGNLEKCASKSSTTGYTTSVSGLGKTSVLSLADDSFRTRNASSVPSSFSPNTPLPS    771 - 840
TSRGTGNSVDPKSSGSKDTQPRKATLKSRKSNP                                         841 - 873
//

Text Mined References (8)

PMID Year Title
18715871 2008 PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11491282 2001 Comparison of ARM and HEAT protein repeats.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9989501 1999 The structure of the protein phosphatase 2A PR65/A subunit reveals the conformation of its 15 tandemly repeated HEAT motifs.