Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.64
PubTator Score 22.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.851 0.000
primary pancreatic ductal adenocarcinoma 1.718 0.000
pancreatic cancer 1.100 0.017

Gene RIF (3)

PMID Text
26324925 PARIS overexpression leads to reduced mitochondrial number and structural abnormalities
24145959 these findings suggest that inhibition of ZNF746 suppresses the invasion and epithelial to mesenchymal transition molecules in H460 NSCLC cells and ZNF746 may be an important target molecule in lung tumorigenesis.
21376232 PARIS(ZNF746) is a KRAB and zinc finger protein that accumulates in models of parkin inactivation and in human PD brain.

AA Sequence

MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTL      1 - 70
LQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAIS     71 - 140
KPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAG    141 - 210
QPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTED    211 - 280
VKIVIKTEVQEEEVVATPVHPTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPAR    281 - 350
PERDMGELSPAVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRP    351 - 420
FNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDGSGPGTGGGGS    421 - 490
GSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTH    491 - 560
TGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQPLPTPPAPPDPFKSPASKGPLASTDLVTDWT    561 - 630
CGLSVLGPTDGGDM                                                            631 - 644
//

Text Mined References (9)

PMID Year Title
26324925 2015 Parkin loss leads to PARIS-dependent declines in mitochondrial mass and respiration.
24145959 2014 Inhibition of ZNF746 suppresses invasion and epithelial to mesenchymal transition in H460 non-small cell lung cancer cells.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21376232 2011 PARIS (ZNF746) repression of PGC-1? contributes to neurodegeneration in Parkinson's disease.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.