Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.94
PubTator Score 22.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 4.2e-08
primary pancreatic ductal adenocarcinoma 1109 5.0e-04
pancreatic cancer 2398 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 0.0 3.0
Disease Target Count Z-score Confidence
Parkinson's disease 392 4.088 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.851 4.2e-08
pancreatic cancer 1.100 1.7e-02
primary pancreatic ductal adenocarcinoma 1.718 5.0e-04

Gene RIF (4)

AA Sequence

MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTL      1 - 70
LQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAIS     71 - 140
KPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAG    141 - 210
QPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTED    211 - 280
VKIVIKTEVQEEEVVATPVHPTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPAR    281 - 350
PERDMGELSPAVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRP    351 - 420
FNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDGSGPGTGGGGS    421 - 490
GSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTH    491 - 560
TGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQPLPTPPAPPDPFKSPASKGPLASTDLVTDWT    561 - 630
CGLSVLGPTDGGDM                                                            631 - 644
//

Text Mined References (11)

PMID Year Title