Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ -1.900 3.5e-04
facioscapulohumeral dystrophy -1.500 4.1e-02
invasive ductal carcinoma -1.900 2.0e-03
osteosarcoma -1.722 1.8e-03
ovarian cancer -1.500 2.3e-07

Gene RIF (1)

AA Sequence

MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAG      1 - 70
HRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGT     71 - 140
VMIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLREA    141 - 210
STEHNCMRTKSRDPLAIYFTSGTTGAPKMVEHSQSSYGLGFVASGRRWVALTESDIFWNTTDTGWVKAAW    211 - 280
TLFSAWPNGSCIFVHELPRVDAKVILNTLSKFPITTLCCVPTIFRLLVQEDLTRYQFQSLRHCLTGGEAL    281 - 350
NPDVREKWKHQTGVELYEGYGQSETVVICANPKGMKIKSGSMGKASPPYDVQIVDDEGNVLPPGEEGNVA    351 - 420
VRIRPTRPFCFFNCYLDNPEKTAASEQGDFYITGDRARMDKDGYFWFMGRNDDVINSSSYRIGPVEVESA    421 - 490
LAEHPAVLESAVVSSPDPIRGEVVKAFIVLTPAYSSHDPEALTRELQEHVKRVTAPYKYPRKVAFVSELP    491 - 560
KTVSGKIQRSKLRSQEWGK                                                       561 - 579
//

Text Mined References (11)

PMID Year Title