Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary


No data available


Accession Q6NUM6 A6NG09 B4DFY2 Q3KQX2
Symbols RSAFD2


PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

DYMARTPHWALFGANERSFDPKDTRHQRKNKSKAISGC                                    631 - 668

Text Mined References (10)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17150819 2006 Ribonucleome analysis identified enzyme genes responsible for wybutosine synthesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16162496 2005 Discovery of a gene family critical to wyosine base formation in a subset of phenylalanine-specific transfer RNAs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.