Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.42
PubTator Score 13.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 2.20601497350026E-25
posterior fossa group A ependymoma 1511 6.75168872163252E-9
lung adenocarcinoma 2714 3.88383448464953E-7
atypical teratoid/rhabdoid tumor 1095 4.69985737630928E-7
sonic hedgehog group medulloblastoma 1482 9.59811023448404E-7
medulloblastoma, large-cell 6234 9.42051389325357E-5
primitive neuroectodermal tumor 3031 5.83848123641809E-4
pediatric high grade glioma 2712 6.56635436764292E-4
breast carcinoma 1614 0.00331782674970963
glioblastoma 5572 0.00658917718444772
lung cancer 4473 0.00750350460984506
astrocytic glioma 2241 0.0308525059033991
Disease Target Count Z-score Confidence
Night Blindness 39 3.113 1.6

Expression

  Differential Expression (12)

Synonym

Accession Q6NUK1 B7ZAI9 Q5T331 Q5T485 Q6PJJ9 Q705K4 Q9P129
Symbols APC1
SCAMC-1

Gene

PDB

4N5X   4ZCU   4ZCV  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
C. elegans OMA Inparanoid

Pathway (1)

Gene RIF (7)

PMID Text
25599384 Genetic analyses in human and mouse models revealed the importance of SLC25A24/Slc25a24 in the regulation of body fat mass and adipogenesis.
24332718 N-terminal EF hands form a self-sequestered compact calmodulin like Ca-sensor in the presence of Ca2+
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15123600 identification of three isoforms of the mitochondrial ATP-Mg/Pi carrier APC1, APC2 and APC3; they are most likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria
15054102 SCaMC-1 is the human orthologue of the rabbit Efinal protein, which was reported to be located in peroxisomes

AA Sequence

MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVN      1 - 70
KDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTM     71 - 140
TVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRT    141 - 210
STAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLT    211 - 280
EEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPN    281 - 350
LLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE    351 - 420
GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK                 421 - 477
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25599384 2015 SLC25A24 as a novel susceptibility gene for low fat mass in humans and mice.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24332718 2014 A self-sequestered calmodulin-like Ca²? sensor of mitochondrial SCaMC carrier and its implication to Ca²?-dependent ATP-Mg/P(i) transport.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22015608 2012 SCaMC-1 promotes cancer cell survival by desensitizing mitochondrial permeability transition via ATP/ADP-mediated matrix Ca(2+) buffering.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...