Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
juvenile dermatomyositis 1187 2.2e-13
ovarian cancer 8520 4.6e-06
glioblastoma 5792 3.6e-05
interstitial cystitis 2312 5.0e-05
adult high grade glioma 3801 1.1e-03
spina bifida 1074 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-03
glioblastoma -1.200 3.6e-05
interstitial cystitis -1.200 5.0e-05
juvenile dermatomyositis -1.373 2.2e-13
ovarian cancer 1.800 4.6e-06
spina bifida -1.554 4.7e-02

Synonym

Accession Q6NUJ5 A6NM90 B5MDQ1 H9KV61 Q5SZI0 Q6ZQX5 Q96F43
Symbols PWWP2
pp8607
bA432J24.1

Gene

PDB

4LD6  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEPRAGCRLPVRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAP      1 - 70
EEGDAEVMQLGSSSPPPARGVQPPETTRPEPPPPLVPPLPAGSLPPYPPYFEGAPFPHPLWLRDTYKLWV     71 - 140
PQPPPRTIKRTRRRLSRNRDPGRLILSTIRLRPRQVLCEKCKSTLSPPEASPGPPAAPRARRRLGSGPDR    141 - 210
ELRKPEEPENGEPTAAATARRSKRERREEDRAPAEQVPRSPVIKISYSTPQGKGEVVKIPSRVHGSLEPF    211 - 280
RPQQAPQDDGSQDPEVLDRESRDRPSCAPSASIPKLKLTRPVPAGADLPPPKIRLKPHRLGDSEHEPVYR    281 - 350
AELVGELNGYLRDSSPAPCADGPAGGLADLSSGSSGEDDDFKSCPQGPQGREGLAFLVSCPEGRADCASE    351 - 420
SACSSDSLDEARSSGSEGTPADTGDLSPGHGASAPSVSREARQTVPPLTVRLHTQSVSECITEDGRTVAV    421 - 490
GDIVWGKIHGFPWWPARVLDISLGQKEDGEPSWREAKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRKKK    491 - 560
GMYRKAITEAANAARHVAPEIRELLTQFET                                            561 - 590
//

Text Mined References (7)

PMID Year Title