Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.200 0.001
oligodendroglioma -3.200 0.000
glioblastoma -4.400 0.000
osteosarcoma -1.207 0.006
ependymoma -2.000 0.000
medulloblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -2.600 0.010
primitive neuroectodermal tumor -2.400 0.016
adult high grade glioma -3.900 0.000
pilocytic astrocytoma -4.000 0.000
pituitary cancer 1.500 0.004
psoriasis 1.100 0.000

AA Sequence

MSARAPKELRLALPPCLLNRTFASPNASGSGNTGARGPGAVGSGTCITQVGQQLFQSFSSTLVLIVLVTL      1 - 70
IFCLIVLSLSTFHIHKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPF     71 - 140
CAPSNASSLSSSSPGLPCQGPCAPPPPPPASSPQGAHAASSCLDTAGEGLLQTVVLS                 141 - 197
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.