Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.8e-13
Atopic dermatitis 952 2.7e-06
medulloblastoma, large-cell 6241 7.4e-06
osteosarcoma 7950 1.0e-04

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis -2.900 2.7e-06
medulloblastoma, large-cell 1.400 7.4e-06
osteosarcoma 1.451 1.0e-04
psoriasis -1.200 6.8e-13

AA Sequence

MLCALLLLPSLLGATRASPTSGPQECAKGSTVWCQDLQTAARCGAVGYCQGAVWNKPTAKSLPCDVCQDI      1 - 70
AAAAGNGLNPDATESDILALVMKTCEWLPSQESSAGCKWMVDAHSSAILSMLRGAPDSAPAQVCTALSLC     71 - 140
EPLQRHLATLRPLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLNIQ    141 - 210
EQCESLGPGLAVLCKNYLFQFFVPADQALRLLPPQELCRKGGFCEELGAPARLTQVVAMDGVPSLELGLP    211 - 280
RKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMITHALERVCSVMPASITKECIILVDTYSPSLVQL    281 - 350
VAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDIL    351 - 420
VAFKGGCSILPLPYMIQCKHFVTQYEPVLIESLKDMMDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWC    421 - 490
RSQEAAKLCNAVQHCQKHVWKEMHLHAGEHA                                           491 - 521
//

Text Mined References (5)

PMID Year Title