Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.35598385986648E-42
Atopic dermatitis 944 2.6736723873068E-6
medulloblastoma, large-cell 6234 7.43486341211014E-6
osteosarcoma 7933 1.00196538503716E-4

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.451 0.000
medulloblastoma, large-cell 1.400 0.000
Atopic dermatitis -2.900 0.000
psoriasis -1.900 0.000

Synonym

Accession Q6NUJ1 A0A184 Q8N7T4
Symbols

Gene

  Ortholog (6)

AA Sequence

MLCALLLLPSLLGATRASPTSGPQECAKGSTVWCQDLQTAARCGAVGYCQGAVWNKPTAKSLPCDVCQDI      1 - 70
AAAAGNGLNPDATESDILALVMKTCEWLPSQESSAGCKWMVDAHSSAILSMLRGAPDSAPAQVCTALSLC     71 - 140
EPLQRHLATLRPLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLNIQ    141 - 210
EQCESLGPGLAVLCKNYLFQFFVPADQALRLLPPQELCRKGGFCEELGAPARLTQVVAMDGVPSLELGLP    211 - 280
RKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMITHALERVCSVMPASITKECIILVDTYSPSLVQL    281 - 350
VAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDIL    351 - 420
VAFKGGCSILPLPYMIQCKHFVTQYEPVLIESLKDMMDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWC    421 - 490
RSQEAAKLCNAVQHCQKHVWKEMHLHAGEHA                                           491 - 521
//

Text Mined References (5)

PMID Year Title
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.