Property Summary

NCBI Gene PubMed Count 6
Grant Count 3
Funding $52,554.01
PubMed Score 6.58
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6NUI2 Q6P2E4 Q6ZNI3 Q6ZNI5 Q6ZWJ4 GPAT-2
Symbols CT123

Gene

Gene RIF (2)

PMID Text
24967918 GPAT2 as a cancer testis gene
18976975 Knockdown of glycerol-3-phosphate acyltransferase 2, mitochondrial (GPAT2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MATMLEGRCQTQPRSSPSGREASLWSSGFGMKLEAVTPFLGKYRPFVGRCCQTCTPKSWESLFHRSITDL      1 - 70
GFCNVILVKEENTRFRGWLVRRLCYFLWSLEQHIPPCQDVPQKIMESTGVQNLLSGRVPGGTGEGQVPDL     71 - 140
VKKEVQRILGHIQAPPRPFLVRLFSWALLRFLNCLFLNVQLHKGQMKMVQKAAQAGLPLVLLSTHKTLLD    141 - 210
GILLPFMLLSQGLGVLRVAWDSRACSPALRALLRKLGGLFLPPEASLSLDSSEGLLARAVVQAVIEQLLV    211 - 280
SGQPLLIFLEEPPGALGPRLSALGQAWVGFVVQAVQVGIVPDALLVPVAVTYDLVPDAPCDIDHASAPLG    281 - 350
LWTGALAVLRSLWSRWGCSHRICSRVHLAQPFSLQEYIVSARSCWGGRQTLEQLLQPIVLGQCTAVPDTE    351 - 420
KEQEWTPITGPLLALKEEDQLLVRRLSCHVLSASVGSSAVMSTAIMATLLLFKHQKLLGEFSWLTEEILL    421 - 490
RGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLAQLSAELLPVFLSEAVGACAV    491 - 560
RGLLAGRVPPQGPWELQGILLLSQNELYRQILLLMHLLPQDLLLLKPCQSSYCYCQEVLDRLIQCGLLVA    561 - 630
EETPGSRPACDTGRQRLSRKLLWKPSGDFTDSDSDDFGEADGRYFRLSQQSHCPDFFLFLCRLLSPLLKA    631 - 700
FAQAAAFLRQGQLPDTELGYTEQLFQFLQATAQEEGIFECADPKLAISAVWTFRDLGVLQQTPSPAGPRL    701 - 770
HLSPTFASLDNQEKLEQFIRQFICS                                                 771 - 795
//

Text Mined References (8)

PMID Year Title
24967918 2014 Glycerol-3-phosphate acyltranferase-2 behaves as a cancer testis gene and promotes growth and tumorigenicity of the breast cancer MDA-MB-231 cell line.
18658143 2008 Thematic review series: glycerolipids. Mammalian glycerol-3-phosphate acyltransferases: new genes for an old activity.
18238778 2008 AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase.
17689486 2007 Cloning and functional characterization of a novel mitochondrial N-ethylmaleimide-sensitive glycerol-3-phosphate acyltransferase (GPAT2).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.