Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.30
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma -1.100 3.1e-04
medulloblastoma, large-cell -1.200 1.4e-02
osteosarcoma 1.394 1.7e-04
ovarian cancer 1.700 5.8e-05
pancreatic ductal adenocarcinoma liver m... -1.290 3.4e-02
Pick disease -1.100 2.7e-03
tuberculosis -1.500 3.4e-07

Gene RIF (5)

AA Sequence

MAASGPGCRSWCLCPEVPSATFFTALLSLLVSGPRLFLLQQPLAPSGLTLKSEALRNWQVYRLVTYIFVY      1 - 70
ENPISLLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAVSSLSKLGEVEDARGFTPVAF     71 - 140
AMLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQTSFLSNVCGLSIGLAYGLTYCYSIDLSERV    141 - 210
ALKLDQTFPFSLMRRISVFKYVSGSSAERRAAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKL    211 - 280
ASWPSCTPGHMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTP    281 - 350
GAAGSKESSRVPMP                                                            351 - 364
//

Text Mined References (17)

PMID Year Title