Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.30
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 3.3963829284324E-7
sonic hedgehog group medulloblastoma 1482 1.15741660161984E-5
ovarian cancer 8492 5.80093316578402E-5
osteosarcoma 7933 1.66451112504064E-4
Pick disease 1893 5.55303052211939E-4
medulloblastoma, large-cell 6234 0.0135896502870194
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0343601560062876

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.394 0.000
sonic hedgehog group medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.200 0.014
pancreatic ductal adenocarcinoma liver m... -1.290 0.034
tuberculosis -1.500 0.000
Pick disease -1.300 0.001
ovarian cancer 1.700 0.000

Synonym

Accession Q6NTF9 Q7L534 Q9H5W6 Q9HBK7 Q9UDT2
Symbols NPD007
RHBDL7

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
24185965 Quantitative reverse transcription-polymerase chain reaction (RT-PCR) analysis showed a significant RHBDD2 mRNA overexpression in advanced breast cancer compared with normal tissue samples (p = 0.012).
24078384 RHBDD2 overexpression in breast cancer could represent an adaptive phenotype to the stressful tumor microenvironment by modulating the endoplasmic reticulum stress response.
23386608 RHBDD2 protein plays important roles in the development and normal function of the retina
22965880 Increased RHBDD2 expression in response to the chemotherapy is associated with advanced stages of colorectal cancer.
19616622 RHBDD2 over-expression behaves as an indicator of poor prognosis and may play a role facilitating breast cancer progression.

AA Sequence

MAASGPGCRSWCLCPEVPSATFFTALLSLLVSGPRLFLLQQPLAPSGLTLKSEALRNWQVYRLVTYIFVY      1 - 70
ENPISLLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAVSSLSKLGEVEDARGFTPVAF     71 - 140
AMLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQTSFLSNVCGLSIGLAYGLTYCYSIDLSERV    141 - 210
ALKLDQTFPFSLMRRISVFKYVSGSSAERRAAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKL    211 - 280
ASWPSCTPGHMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTP    281 - 350
GAAGSKESSRVPMP                                                            351 - 364
//

Text Mined References (13)

PMID Year Title
24185965 2014 Rhomboid family gene expression profiling in breast normal tissue and tumor samples.
24078384 2014 Identification of signaling pathways modulated by RHBDD2 in breast cancer cells: a link to the unfolded protein response.
23386608 2013 Dynamics of the rhomboid-like protein RHBDD2 expression in mouse retina and involvement of its human ortholog in retinitis pigmentosa.
22965880 2012 RHBDD2: a 5-fluorouracil responsive gene overexpressed in the advanced stages of colorectal cancer.
19616622 2009 Rhomboid domain containing 2 (RHBDD2): a novel cancer-related gene over-expressed in breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
More...