Property Summary

NCBI Gene PubMed Count 45
Grant Count 41
R01 Count 19
Funding $4,306,243.16
PubMed Score 37.86
PubTator Score 33.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Acquired immunodeficiency syndrome 164 3.085 1.5

Expression

Gene RIF (104)

PMID Text
26459911 The eQTL-missense polymorphisms of APOBEC3H are associated with lung cancer risk in a Han Chinese population
26396192 APOBEC3H haplotype II was able to processively deaminate multiple cytosines in a single enzyme-substrate encounter by using sliding, jumping, and intersegmental transfer movements.
26396192 HIV-1 (delta Vif) replication is restricted by APOBEC3H haplotypes II and V with similar efficiences, but by different mechanisms
25721876 A3H with low anti-HIV-1 activity, APOBEC3H-hapC, is associated with the susceptibility to HIV-1 infection, whereas the A3H producing a stable protein, A3H-hapB, may confer a low risk of disease progression to AIDS.
25614027 Importantly, APOBEC3H appears to use both deaminase-dependent and -independent mechanisms to target reverse transcription and restrict HIV-1 replication.
25590520 The existence and persistence of both types of HIV-1 Vif variant suggests the importance of APOBEC3H suppression and cell cycle regulation for HIV-1's survival in vivo.
25590520 The combination of N48H and GDAK60-63EKGE results in a hyperfunctional Vif protein capable of fully inhibiting stable APOBEC3H-hapII
25590520 The combination of N48H and GDAK60-63EKGE results in a hyperfunctional Vif protein capable of fully inhibiting stable APOBEC3H-hapII
25590520 The combination of N48H and GDAK60-63EKGE results in a hyperfunctional Vif protein capable of fully inhibiting stable APOBEC3H-hapII
25590520 The combination of N48H and GDAK60-63EKGE results in a hyperfunctional Vif protein capable of fully inhibiting stable APOBEC3H-hapII
More...

AA Sequence

MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDE      1 - 70
TQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPK     71 - 140
FADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV              141 - 200
//

Text Mined References (51)

PMID Year Title
26459911 2015 The eQTL-missense polymorphisms of APOBEC3H are associated with lung cancer risk in a Han Chinese population.
26396192 2015 Natural Polymorphisms and Oligomerization of Human APOBEC3H Contribute to Single-stranded DNA Scanning Ability.
25721876 2015 APOBEC3H polymorphisms associated with the susceptibility to HIV-1 infection and AIDS progression in Japanese.
25614027 2015 Sequence and structural determinants of human APOBEC3H deaminase and anti-HIV-1 activities.
25590520 2015 Evolutionarily conserved pressure for the existence of distinct G2/M cell cycle arrest and A3H inactivation functions in HIV-1 Vif.
25411794 2014 Natural polymorphisms in human APOBEC3H and HIV-1 Vif combine in primary T lymphocytes to affect viral G-to-A mutation levels and infectivity.
25053361 2014 Alcohol enhances HIV infection of cord blood monocyte-derived macrophages.
24942576 2014 HIV-1 and HIV-2 Vif interact with human APOBEC3 proteins using completely different determinants.
24361275 2014 APOBEC3 multimerization correlates with HIV-1 packaging and restriction activity in living cells.
24227842 2014 APOBEC3 deaminases induce hypermutation in human papillomavirus 16 DNA upon beta interferon stimulation.
More...