Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 5.7e-07
osteosarcoma 7950 2.2e-06
psoriasis 6694 7.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.600 5.7e-07
osteosarcoma -1.735 2.2e-06
psoriasis -1.400 7.6e-05

Gene RIF (2)

AA Sequence

MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELP      1 - 70
LRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGP     71 - 140
RFSQDLPRKRKWSRSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRG    141 - 210
PGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPT    211 - 280
AAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV           281 - 343
//

Text Mined References (12)

PMID Year Title