Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.27
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
23622239 TRNP1 expression levels exhibit regional differences in the cerebral cortex of human fetuses, anticipating radial or tangential expansion.

AA Sequence

MPGCRISACGPGAQEGTAEQRSPPPPWDPMPSSQPPPPTPTLTPTPTPGQSPPLPDAAGASAGAAEDQEL      1 - 70
QRWRQGASGIAGLAGPGGGSGAAAGAGGRALELAEARRRLLEVEGRRRLVSELESRVLQLHRVFLAAELR     71 - 140
LAHRAESLSRLSGGVAQAELYLAAHGSRLKKGPRRGRRGRPPALLASALGLGGCVPWGAGRLRRGHGPEP    141 - 210
DSPFRRSPPRGPASPQR                                                         211 - 227
//

Text Mined References (5)

PMID Year Title
23622239 2013 Trnp1 regulates expansion and folding of the mammalian cerebral cortex by control of radial glial fate.
16792503 2006 trnp: A conserved mammalian gene encoding a nuclear protein that accelerates cell-cycle progression.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.