Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.47
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 2.849 3.4e-02
adult high grade glioma -1.500 1.3e-03
astrocytic glioma -2.500 2.5e-03
atypical teratoid / rhabdoid tumor -1.500 1.3e-02
cystic fibrosis 1.100 5.8e-04
ependymoma -2.500 4.5e-03
glioblastoma -1.700 2.1e-06
group 3 medulloblastoma -2.900 3.1e-06
inflammatory breast cancer -1.900 1.8e-03
interstitial cystitis -2.200 1.1e-03
intraductal papillary-mucinous adenoma (... 2.300 1.2e-03
intraductal papillary-mucinous carcinoma... 1.800 2.3e-02
intraductal papillary-mucinous neoplasm ... 2.300 1.7e-02
medulloblastoma, large-cell -1.200 4.5e-04
nasopharyngeal carcinoma -1.200 1.0e-06
oligodendroglioma -2.200 5.8e-03
osteosarcoma 1.543 3.6e-04
ovarian cancer -1.800 5.0e-05
pancreatic cancer 1.600 9.6e-06
pituitary cancer 1.200 2.2e-06
primitive neuroectodermal tumor -1.100 2.8e-03

Gene RIF (1)

AA Sequence

MPGCRISACGPGAQEGTAEQRSPPPPWDPMPSSQPPPPTPTLTPTPTPGQSPPLPDAAGASAGAAEDQEL      1 - 70
QRWRQGASGIAGLAGPGGGSGAAAGAGGRALELAEARRRLLEVEGRRRLVSELESRVLQLHRVFLAAELR     71 - 140
LAHRAESLSRLSGGVAQAELYLAAHGSRLKKGPRRGRRGRPPALLASALGLGGCVPWGAGRLRRGHGPEP    141 - 210
DSPFRRSPPRGPASPQR                                                         211 - 227
//

Text Mined References (5)

PMID Year Title