Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
Funding $350,949.34
PubMed Score 28.35
PubTator Score 21.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
oligodendroglioma 1.300 0.003
primary pancreatic ductal adenocarcinoma -1.239 0.022
breast carcinoma -1.200 0.033
lung adenocarcinoma 2.500 0.006
Alzheimer's disease 1.100 0.023
ductal carcinoma in situ -1.100 0.035
ovarian cancer -1.400 0.000
pancreatic cancer -1.200 0.012

Gene RIF (11)

PMID Text
26456220 HMBOX1 regulates intracellular free zinc level by interacting with MT2A to inhibit apoptosis and promote autophagy in vascular endothelial cells.
23813958 a homeobox-containing protein known as HMBOX1 can directly bind telomeric double-stranded DNA and associate with PML nuclear bodies.
23685356 HOT1 supports telomerase-dependent telomere elongation.
22320217 our results revealed a novel regulatory mechanism: miR-30c-1(*) promoted NK cell cytotoxicity against hepatoma cells by targeting HMBOX1.
21839858 HMBOX1 may function as a negative regulator of IFN-gamma in NK cells.
21706044 HMBOX1 negatively regulates the expression of NKG2D and the activation of the NKG2D/DAP10 signaling pathway in NK cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20182437 higher HMGB1(homeobox containing 1) levels in Tracheal aspirates are associated with the development of bronchopulmonary dysplasia or death in ventilated premature infants.
19757162 These findings suggest a distinct role of HMBOX1b, and the control of mRNA splicing might be involved in homeobox genes regulation.
19728927 decreased expression in hepatic carcinoma
More...

AA Sequence

MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGS      1 - 70
SYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHAN     71 - 140
SMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQG    141 - 210
SDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLA    211 - 280
VMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES    281 - 350
HGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD    351 - 420
//

Text Mined References (28)

PMID Year Title
26456220 2015 HMBOX1 interacts with MT2A to regulate autophagy and apoptosis in vascular endothelial cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
23813958 2013 The telomere-associated homeobox-containing protein TAH1/HMBOX1 participates in telomere maintenance in ALT cells.
23685356 2013 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...