Property Summary

NCBI Gene PubMed Count 13
PubMed Score 114.69
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEK      1 - 70
EGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQC     71 - 140
ALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ                   141 - 195
//

Text Mined References (17)

PMID Year Title