Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $152,254
PubMed Score 110.94
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
23774837 The presence of CGB1 and CGB2 transcripts in 41% of analyzed ovarian cancer cases, is reported.
17055150 In silico prediction of putative transcription factor binding sites supports the hypothesis that CGB1 and CGB2 gene products are expressed in, and may contribute to, implantation and placental development.

AA Sequence

MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEK      1 - 70
EGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQC     71 - 140
ALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ                   141 - 195
//

Text Mined References (17)

PMID Year Title
24778026 2014 Novel insights into the expression of CGB1 & 2 genes by epithelial cancer cell lines secreting ectopic free hCG?.
23774837 2013 Human chorionic gonadotropin beta subunit genes CGB1 and CGB2 are transcriptionally active in ovarian cancer.
19523396 2009 Molecular cloning, characterization and expression of thyroid-stimulating hormone receptor in channel catfish.
18048458 2008 Fine-scale quantification of HCG beta gene transcription in human trophoblastic and non-malignant non-trophoblastic tissues.
17055150 2007 The evolution and genomic landscape of CGB1 and CGB2 genes.
16123088 2005 Expression of beta-subunit of HCG genes during normal and failed pregnancy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
More...