Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.29

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGQDEGASAGQGPK      1 - 70
PEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                             71 - 116
//

Text Mined References (8)

PMID Year Title