Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $194,877
PubMed Score 0.31

Knowledge Summary

Patent

No data available

Synonym

Accession Q6NT46 GAGE-2A
Symbols CT4.2
GAGE2
GAGE-2
GAGE-2A

Gene

 Grant Application (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
19934278 Data show that EZH2 is a crucial regulator of GAGE2 expression.

AA Sequence

MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGQDEGASAGQGPK      1 - 70
PEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                             71 - 116
//

Text Mined References (8)

PMID Year Title
19934278 2009 Combinatorial pharmacologic approaches target EZH2-mediated gene repression in breast cancer cells.
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10397259 1999 Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.
7544395 1995 A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.