Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.98
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.200 1.5e-03
cystic fibrosis 1.573 7.3e-06
group 3 medulloblastoma -2.200 2.1e-03
intraductal papillary-mucinous adenoma (... 1.200 1.2e-02
intraductal papillary-mucinous carcinoma... 1.200 2.7e-02
medulloblastoma, large-cell -2.000 3.4e-03
osteosarcoma -1.287 1.6e-03
ovarian cancer -2.300 1.1e-05
tuberculosis 1.100 1.6e-04

AA Sequence

MEALGDLEGPRAPGGDDPAGSAGETPGWLSREQVFVLISAASVNLGSMMCYSILGPFFPKEAEKKGASNT      1 - 70
IIGMIFGCFALFELLASLVFGNYLVHIGAKFMFVAGMFVSGGVTILFGVLDRVPDGPVFIAMCFLVRVMD     71 - 140
AVSFAAAMTASSSILAKAFPNNVATVLGSLETFSGLGLILGPPVGGFLYQSFGYEVPFIVLGCVVLLMVP    141 - 210
LNMYILPNYESDPGEHSFWKLIALPKVGLIAFVINSLSSCFGFLDPTLSLFVLEKFNLPAGYVGLVFLGM    211 - 280
ALSYAISSPLFGLLSDKRPPLRKWLLVFGNLITAGCYMLLGPVPILHIKSQLWLLVLILVVSGLSAGMSI    281 - 350
IPTFPEILSCAHENGFEEGLSTLGLVSGLFSAMWSIGAFMGPTLGGFLYEKIGFEWAAAIQGLWALISGL    351 - 420
AMGLFYLLEYSRRKRSKSQNILSTEEERTTLLPNET                                      421 - 456
//

Text Mined References (8)

PMID Year Title