Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.22
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adrenocortical carcinoma 1428 4.0e-06
osteosarcoma 7950 4.4e-03
ovarian cancer 8520 1.4e-02
spina bifida 1074 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 1.797 4.0e-06
osteosarcoma -1.116 4.4e-03
ovarian cancer 1.300 1.4e-02
spina bifida -1.631 3.2e-02

Gene RIF (1)

AA Sequence

MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRK      1 - 70
RTTGAKYGDVDDAVYMWYQQKRSAGVPVRGVELQAAAERFARCFGRTDFKASTGWLFRFRNRHAIGNRKG     71 - 140
CGEQVLSSVSENVEPFRQKLSMIIKEEKLCLAQLYSGDETDLFWKSMPENSQASRKDICLPGKKINKERL    141 - 210
SAFLCANADGTHKLKSIIIGKSKLPKSVKEDTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHFQLN    211 - 280
VLRFHDEDVRALLLLDSCPAHPSSESLTSEDGRIKCMFFPHNTSTLIQPMNQGVILSCKRLYRWKQLEES    281 - 350
LVIFEESDDEQEKGDKGVSKIKIYNIKSAIFNWAKSWEEVKQITIANAWENLLYKKEPEYDFQGLEHGDY    351 - 420
REILEKCGELETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSAVRESLDYLLDF    421 - 490
VDATPEFQRFHFTLKEMQQEIVKKQFQSKIHSRIGSFLKPRPHNIKDSFSGPSTSGSNH               491 - 549
//

Text Mined References (5)

PMID Year Title