Property Summary

NCBI Gene PubMed Count 15
Grant Count 308
R01 Count 130
Funding $34,510,075.04
PubMed Score 1025.54
PubTator Score 8.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 5.705 2.9
Gonadoblastoma 27 3.348 1.7

Synonym

Accession Q6NSW7
Symbols PN8
NANOG
NANOGP1

Gene

PDB

4RBO  

 GO Component (1)

Gene RIF (9)

PMID Text
26087476 Results indicate that NANOG and NANOGP8 proteins are expressed in prostate cancer cell lines, and NANOG and NANOGP8 equally contribute to the high malignant potential of prostate cancer.
26062418 NANOGP8 has a close relationship with the proliferation, cycle, apoptosis, migration and invasion of SGC-7901 gastric cancer cells
24598770 Unique biochemical properties of Nanog1 in embryonal carcinoma cells and NanogP8 in somatic cancer cells.
23839044 High levels of NanogP8 may disrupt normal developmental programs and inhibit tumor development by depleting stem cells.
23752184 These results show that cancer-associated NANOGP8 can contribute to promote de-differentiation and/or cellular plasticity.
23173096 A comparative genomic approach identifies a series of retrotranspositional and mutational events that allowed NANOGP8 to evolve as a human-specific retro-oncogene.
22079639 these data indicate that nanog1 and nanogp8 are differentially expressed in colon cancer cells, and suggest that their expression contributes to proliferation of colon cancer cells.
21136380 conclude that eNANOG is not exclusively expressed in undifferentiated cells and that both embryonic NANOG and NANOGP8 may function as transcription factors in a cell type-specific manner
20581802 NANOGP8 is expressed in primary human glioblastoma and is required for glioblastoma growth in xenograft assay in mice

AA Sequence

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSST      1 - 70
SPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVK     71 - 140
TWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQT    141 - 210
QNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQT    211 - 280
TRYFSTPQTMDLFLNYSMNMQPEDV                                                 281 - 305
//

Text Mined References (16)

PMID Year Title
26087476 2015 CRISPR/Cas9-mediated gene knockout of NANOG and NANOGP8 decreases the malignant potential of prostate cancer cells.
26062418 2015 [The expression of retrogene Nanogp8 is related to the biological characteristics of human SGC-7901 gastric cancer cells].
24598770 2014 Nanog1 in NTERA-2 and recombinant NanogP8 from somatic cancer cells adopt multiple protein conformations and migrate at multiple M.W species.
23839044 2013 In vivo functional studies of tumor-specific retrogene NanogP8 in transgenic animals.
23752184 2014 Reprogramming activity of NANOGP8, a NANOG family member widely expressed in cancer.
23173096 2012 NANOGP8: evolution of a human-specific retro-oncogene.
22079639 2012 Differential expression of nanog1 and nanogp8 in colon cancer cells.
21136380 2010 Expression of NANOG and NANOGP8 in a variety of undifferentiated and differentiated human cells.
20581802 2010 NANOG regulates glioma stem cells and is essential in vivo acting in a cross-functional network with GLI1 and p53.
19415763 2009 Functional evidence that the self-renewal gene NANOG regulates human tumor development.
More...