Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
osteosarcoma 7950 3.371 1.7

Synonym

Accession Q6NSW5 Q5H9G7 Q9NZ36
Symbols HT011
FAM45B

Gene

 Compartment GO Term (1)

AA Sequence

MAAAELADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFY      1 - 70
ITIIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEEN     71 - 140
GSFLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDW    141 - 210
TILHSYVHLNADELEALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMG    211 - 280
QLIVQSAEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAA    281 - 350
AEQMLKI                                                                   351 - 357
//

Text Mined References (5)

PMID Year Title