Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.37
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
ductal carcinoma in situ 1.300 9.2e-04
interstitial cystitis -1.200 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.6e-03
invasive ductal carcinoma 1.600 2.0e-03
non-small cell lung cancer 1.008 1.9e-07
osteosarcoma 3.348 1.3e-03
psoriasis 1.200 4.9e-03

Gene RIF (2)

AA Sequence

MIPVAEFKQFTEQQPAFKVLKPWWDVLAEYLTVAMLMIGVFGCTLQVTQDKIICLPNHELQENLSEAPCQ      1 - 70
QLLPRGIPEQIGALQEVKGLKNNLDLQQYSFINQLCYETALHWYAKYFPYLVVIHTLIFMVCTSFWFKFP     71 - 140
GTSSKIEHFISILGKCFDSPWTTRALSEVSGENQKGPAATERAAATIVAMAGTGPGKAGEGEKEKVLAEP    141 - 210
EKVVTEPPVVTLLDKKEGEQAKALFEKVKKFRMHVEEGDILYTMYIRQTVLKVCKFLAILVYNLVYVEKI    211 - 280
SFLVACRVETSEVTGYASFCCNHTKAHLFSKLAFCYISFVCIYGLTCIYTLYWLFHRPLKEYSFRSVREE    281 - 350
TGMGDIPDVKNDFAFMLHLIDQYDSLYSKRFAVFLSEVSESRLKQLNLNHEWTPEKLRQKLQRNAAGRLE    351 - 420
LALCMLPGLPDTVFELSEVESLRLEAICDITFPPGLSQLVHLQELSLLHSPARLPFSLQVFLRDHLKVMR    421 - 490
VKCEELREVPLWVFGLRGLEELHLEGLFPQELARAATLESLRELKQLKVLSLRSNAGKVPASVTDVAGHL    491 - 560
QRLSLHNDGARLVALNSLKKLAALRELELVACGLERIPHAVFSLGALQELDLKDNHLRSIEEILSFQHCR    561 - 630
KLVTLRLWHNQIAYVPEHVRKLRSLEQLYLSYNKLETLPSQLGLCSGLRLLDVSHNGLHSLPPEVGLLQN    631 - 700
LQHLALSYNALEALPEELFFCRKLRTLLLGDNQLSQLSPHVGALRALSRLELKGNRLEALPEELGNCGGL    701 - 770
KKAGLLVEDTLYQGLPAEVRDKMEEE                                                771 - 796
//

Text Mined References (15)

PMID Year Title