Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.98
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.200 0.005
osteosarcoma 3.348 0.001
non-small cell lung cancer 1.026 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.003
interstitial cystitis -1.200 0.010
ductal carcinoma in situ 1.800 0.001
invasive ductal carcinoma 1.900 0.005

Synonym

Accession Q6NSJ5 B3KR78 Q2YDY3 Q7L236 Q8N3B0 Q9H5H8
Symbols

Gene

Gene RIF (2)

PMID Text
18854154 Knockdown of leucine rich repeat containing 8 family, member E (LRRC8E) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15094057 identified four genes, named TA-LRRP, AD158, LRRC5, and FLJ23420, as unknown LRRC8-like genes

AA Sequence

MIPVAEFKQFTEQQPAFKVLKPWWDVLAEYLTVAMLMIGVFGCTLQVTQDKIICLPNHELQENLSEAPCQ      1 - 70
QLLPRGIPEQIGALQEVKGLKNNLDLQQYSFINQLCYETALHWYAKYFPYLVVIHTLIFMVCTSFWFKFP     71 - 140
GTSSKIEHFISILGKCFDSPWTTRALSEVSGENQKGPAATERAAATIVAMAGTGPGKAGEGEKEKVLAEP    141 - 210
EKVVTEPPVVTLLDKKEGEQAKALFEKVKKFRMHVEEGDILYTMYIRQTVLKVCKFLAILVYNLVYVEKI    211 - 280
SFLVACRVETSEVTGYASFCCNHTKAHLFSKLAFCYISFVCIYGLTCIYTLYWLFHRPLKEYSFRSVREE    281 - 350
TGMGDIPDVKNDFAFMLHLIDQYDSLYSKRFAVFLSEVSESRLKQLNLNHEWTPEKLRQKLQRNAAGRLE    351 - 420
LALCMLPGLPDTVFELSEVESLRLEAICDITFPPGLSQLVHLQELSLLHSPARLPFSLQVFLRDHLKVMR    421 - 490
VKCEELREVPLWVFGLRGLEELHLEGLFPQELARAATLESLRELKQLKVLSLRSNAGKVPASVTDVAGHL    491 - 560
QRLSLHNDGARLVALNSLKKLAALRELELVACGLERIPHAVFSLGALQELDLKDNHLRSIEEILSFQHCR    561 - 630
KLVTLRLWHNQIAYVPEHVRKLRSLEQLYLSYNKLETLPSQLGLCSGLRLLDVSHNGLHSLPPEVGLLQN    631 - 700
LQHLALSYNALEALPEELFFCRKLRTLLLGDNQLSQLSPHVGALRALSRLELKGNRLEALPEELGNCGGL    701 - 770
KKAGLLVEDTLYQGLPAEVRDKMEEE                                                771 - 796
//

Text Mined References (15)

PMID Year Title
26824658 2016 LRRC8 Proteins Form Volume-Regulated Anion Channels that Sense Ionic Strength.
24790029 2014 Identification of LRRC8 heteromers as an essential component of the volume-regulated anion channel VRAC.
22532330 2012 LRRC8 proteins share a common ancestor with pannexins, and may form hexameric channels involved in cell-cell communication.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15094057 2004 LRRC8 involved in B cell development belongs to a novel family of leucine-rich repeat proteins.
More...