Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -1.164 2.9e-02
adrenocortical carcinoma -1.025 2.4e-03
atypical teratoid / rhabdoid tumor 1.300 4.7e-05
gastric carcinoma 1.100 3.1e-02
interstitial cystitis -1.400 1.6e-03
osteosarcoma 1.248 1.7e-03
spina bifida -2.213 3.3e-02
tuberculosis -2.000 2.0e-07

Synonym

Accession Q6NSJ2 Q8N7Z4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

AA Sequence

MGTRSSPEEGTPPPLVPECDVEVQPQGHPEESREQEASEVLAEPSSRGGAEQQAEEEEVGEGSSTESSRD      1 - 70
APEATPPIAMAATPPASTSSREGVRGAARRLQGQQLEALTRVALMEQRVKELQRQRKELRIEMEVEVALL     71 - 140
RGELAGERVAARREEEQLRELLEQQAASEQRGRQQREQEQRRLSQERDRLEGLRQRLRKAQGQLDSQPED    141 - 210
QRERLLQGVQEMREQLDVAQRAYEDLEFQQLERESRQEEEDRDSPGPQVPDPKVQELQASMAQHRRGALQ    211 - 280
HRIRVLEEQLKSLGEQMAAESRGLSRKKEEALQALSQERSRLLELNCLQGTPGGDFSEPNPALTKLLFTQ    281 - 350
KTDRQLLVLQDAVAHSAATPTSSCLFSVHSSLQGSIGLQRTGSLPRKRGERGSQRGSPRPLSFHCTESLE    351 - 420
ASALPPAVGDSGRYPLYQLLNCGRGNSCGAIHPDIAHMERLLQQAMAERERLLKAREGTRRGTEGSSGPA    421 - 490
VPAITAPPTPPHPPGPRILDLRQHLEGWGHNPENCPHVQVSGCCCRGPLVKMGGRIKTWRKRWFCFDRQA    491 - 560
RRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPNPRLTFCVKTYERLFYMVAPSPEAMRIWMDVI    561 - 630
VTAADENHAP                                                                631 - 640
//

Text Mined References (8)

PMID Year Title