Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.248 0.002
atypical teratoid/rhabdoid tumor 1.400 0.000
adrenocortical carcinoma -1.025 0.002
tuberculosis -2.000 0.000
active Crohn's disease -1.164 0.029
interstitial cystitis -1.400 0.002
spina bifida -2.213 0.033
gastric carcinoma 1.100 0.031

Synonym

Accession Q6NSJ2 Q8N7Z4
Symbols

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MGTRSSPEEGTPPPLVPECDVEVQPQGHPEESREQEASEVLAEPSSRGGAEQQAEEEEVGEGSSTESSRD      1 - 70
APEATPPIAMAATPPASTSSREGVRGAARRLQGQQLEALTRVALMEQRVKELQRQRKELRIEMEVEVALL     71 - 140
RGELAGERVAARREEEQLRELLEQQAASEQRGRQQREQEQRRLSQERDRLEGLRQRLRKAQGQLDSQPED    141 - 210
QRERLLQGVQEMREQLDVAQRAYEDLEFQQLERESRQEEEDRDSPGPQVPDPKVQELQASMAQHRRGALQ    211 - 280
HRIRVLEEQLKSLGEQMAAESRGLSRKKEEALQALSQERSRLLELNCLQGTPGGDFSEPNPALTKLLFTQ    281 - 350
KTDRQLLVLQDAVAHSAATPTSSCLFSVHSSLQGSIGLQRTGSLPRKRGERGSQRGSPRPLSFHCTESLE    351 - 420
ASALPPAVGDSGRYPLYQLLNCGRGNSCGAIHPDIAHMERLLQQAMAERERLLKAREGTRRGTEGSSGPA    421 - 490
VPAITAPPTPPHPPGPRILDLRQHLEGWGHNPENCPHVQVSGCCCRGPLVKMGGRIKTWRKRWFCFDRQA    491 - 560
RRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPNPRLTFCVKTYERLFYMVAPSPEAMRIWMDVI    561 - 630
VTAADENHAP                                                                631 - 640
//

Text Mined References (8)

PMID Year Title
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.