Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 1.96467566930541E-7
atypical teratoid/rhabdoid tumor 1095 7.46986753048108E-7
interstitial cystitis 2299 0.00163911502308694
osteosarcoma 7933 0.00167819138567661
adrenocortical carcinoma 1427 0.00235609814163369
active Crohn's disease 918 0.0291527578311049
gastric carcinoma 832 0.0307663023231175
spina bifida 1064 0.0331994072194255

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.248 0.002
atypical teratoid/rhabdoid tumor 1.400 0.000
adrenocortical carcinoma -1.025 0.002
tuberculosis -2.000 0.000
active Crohn's disease -1.164 0.029
interstitial cystitis -1.400 0.002
spina bifida -2.213 0.033
gastric carcinoma 1.100 0.031

Synonym

Accession Q6NSJ2 Q8N7Z4
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 GO Function (1)

AA Sequence

MGTRSSPEEGTPPPLVPECDVEVQPQGHPEESREQEASEVLAEPSSRGGAEQQAEEEEVGEGSSTESSRD      1 - 70
APEATPPIAMAATPPASTSSREGVRGAARRLQGQQLEALTRVALMEQRVKELQRQRKELRIEMEVEVALL     71 - 140
RGELAGERVAARREEEQLRELLEQQAASEQRGRQQREQEQRRLSQERDRLEGLRQRLRKAQGQLDSQPED    141 - 210
QRERLLQGVQEMREQLDVAQRAYEDLEFQQLERESRQEEEDRDSPGPQVPDPKVQELQASMAQHRRGALQ    211 - 280
HRIRVLEEQLKSLGEQMAAESRGLSRKKEEALQALSQERSRLLELNCLQGTPGGDFSEPNPALTKLLFTQ    281 - 350
KTDRQLLVLQDAVAHSAATPTSSCLFSVHSSLQGSIGLQRTGSLPRKRGERGSQRGSPRPLSFHCTESLE    351 - 420
ASALPPAVGDSGRYPLYQLLNCGRGNSCGAIHPDIAHMERLLQQAMAERERLLKAREGTRRGTEGSSGPA    421 - 490
VPAITAPPTPPHPPGPRILDLRQHLEGWGHNPENCPHVQVSGCCCRGPLVKMGGRIKTWRKRWFCFDRQA    491 - 560
RRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPNPRLTFCVKTYERLFYMVAPSPEAMRIWMDVI    561 - 630
VTAADENHAP                                                                631 - 640
//

Text Mined References (8)

PMID Year Title
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.