Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.08
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession Q6NSI8 Q49AF0 Q6ZND0 Q96JI6
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRGYSENNNFLNNNNQMVLDMILYPLIGIPQTINWETIARLVPGLTPKECAKRFDELKSSGSSPVDNQY      1 - 70
NSLMAAGESPVETLATYIKSSLLDIHGEFQETPVGHDAVSKTGRHSIASTRNCSSESENCTTHNGGEMTE     71 - 140
ESEGPNMVIHVCDEAKNLKEDFTCPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYIKR    141 - 210
NTKENKDCEMPTLEPGNVISILISSEFLKMDSLVEQCIQYCHKNMNAIVATPCNMNCINANLLTRIADLF    211 - 280
SHNEVDDLKDKKDKFKSKLFCKKIERLFDPEYLNPDSRSNAATLYRCCLCKKLLTKETERRIPCIPGKIN    281 - 350
VDRRGNIVYIHIRDKTWDVHEYLNSLFEELKSWRDVYWRLWGTINWLTCSRCYQAFLCIEFSHCQYHSET    351 - 420
VVYPTAASSLNTVGTGIYPCCNQKVLRFDPTQLTKGCKVRDHMVTLRDQGEGGDLPSCPTARMLDDLHKY    421 - 490
RDVIVVPFSKDTVSDVGVGLCDEKGIECDVLLEPNTPWGPKTGELNAFLSLKNWTLQLKQQSLFSEEEEY    491 - 560
TTGSEVTEDEVGDEEEVSKKQRKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKW    561 - 630
DATRSLRFNQDAQREDDQRRMTEITGHLIKMRLGDLDRVKSKEAKEFAGGIYSRLEAQIKASVPVSARQS    631 - 700
SSEKNTRSKSRFGQGRPA                                                        701 - 718
//

Text Mined References (8)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.