Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.09
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.671 0.000
malignant mesothelioma -3.000 0.000
psoriasis -1.100 0.003
posterior fossa group B ependymoma 2.400 0.000
atypical teratoid / rhabdoid tumor -1.200 0.037
medulloblastoma, large-cell -2.100 0.001
tuberculosis -1.100 0.000
lung cancer -1.700 0.000
interstitial cystitis -2.400 0.000
lung adenocarcinoma -1.100 0.000
pilocytic astrocytoma 1.700 0.000
lung carcinoma 1.700 0.000
Pick disease -1.100 0.000
Breast cancer -2.300 0.000
acute myeloid leukemia -1.200 0.012
ovarian cancer -3.300 0.000
chronic rhinosinusitis -1.414 0.009
cystic fibrosis and chronic rhinosinusit... -1.338 0.039

AA Sequence

MSGESGQPEAGPSHAGLDWPNPERNRAGVPGGVIRRAGSQGPRSWIQKVLEQIMDSPRQCVTPSEVVPVT      1 - 70
VLAVQRYLLEDEPRDTVPKPPLYCYDVTISDGVYQEKCYLDPSLNSLVYQNILKVGIQMRISRVSCLYNE     71 - 140
KRIGQGILCIDNVHCGETSDSISLETPFRNRAHQEKPERPLRGGKSHYLALWNNEDPYGDIWLTDKQPEE    141 - 210
HNFSDTKIISLSHLEMTWTNRRNFPALLVRILHKSKLRYYGKPDKKMIEPYQTFLEVADSSGTVSVIMWN    211 - 280
ALCPEWYKSLRVGLVLLLQDYSVKKSYPFRIQPVPVDPQIKLISTMEICLNLRDPPTNIIIIPEKQVKPE    281 - 350
WRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVEL    351 - 420
FSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKLLYLTTTNESGVFITGHRGQPYTYDAKVKNFIQWIR    421 - 490
TKSDSGEQKNMVIGGYYPYPPVPETFSKYSSSIKVESLLTAISEVRKEIEDLQYREQKRIAIQGIITAIK    491 - 560
YIPHSSATESASASETLRNANRPSTSQAARVEIQERNGKRHQDDEPVNSQYFQTTSTNLSLSNKIRILQG    561 - 630
PHANPVAVPQPGASVQTKGIKPGMPSIFNRRANINANLQGKARKTISDRWESQLWREKKFGLIDHLHYSR    631 - 700
VYPESIPRKFMFEHRKFLSDQYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLP    701 - 770
MYCPEDIRTSQIDTLLTSMNYSCAYPQDTTGNDRLPGPRAVAGDIIKAATELDRVHIVGILDICNLGNNK    771 - 840
VEVYLHKIYSPENTS                                                           841 - 855
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.