Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.09
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.200 1.2e-02
Astrocytoma, Pilocytic 1.700 1.2e-05
atypical teratoid / rhabdoid tumor -1.200 3.7e-02
Breast cancer -2.300 5.5e-12
Chronic Lymphocytic Leukemia -1.671 5.1e-08
chronic rhinosinusitis -1.414 9.1e-03
cystic fibrosis and chronic rhinosinusit... -1.338 3.9e-02
ependymoma 1.700 2.1e-04
interstitial cystitis -2.000 1.8e-03
lung adenocarcinoma -1.100 4.6e-15
lung cancer -1.400 3.1e-02
lung carcinoma 1.700 4.5e-18
malignant mesothelioma -3.000 1.1e-08
medulloblastoma, large-cell -2.100 1.1e-03
ovarian cancer -3.300 2.0e-19
Pick disease -1.100 3.9e-04
psoriasis -1.100 2.6e-03
tuberculosis -1.100 4.1e-05

Gene RIF (1)

AA Sequence

MSGESGQPEAGPSHAGLDWPNPERNRAGVPGGVIRRAGSQGPRSWIQKVLEQIMDSPRQCVTPSEVVPVT      1 - 70
VLAVQRYLLEDEPRDTVPKPPLYCYDVTISDGVYQEKCYLDPSLNSLVYQNILKVGIQMRISRVSCLYNE     71 - 140
KRIGQGILCIDNVHCGETSDSISLETPFRNRAHQEKPERPLRGGKSHYLALWNNEDPYGDIWLTDKQPEE    141 - 210
HNFSDTKIISLSHLEMTWTNRRNFPALLVRILHKSKLRYYGKPDKKMIEPYQTFLEVADSSGTVSVIMWN    211 - 280
ALCPEWYKSLRVGLVLLLQDYSVKKSYPFRIQPVPVDPQIKLISTMEICLNLRDPPTNIIIIPEKQVKPE    281 - 350
WRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVEL    351 - 420
FSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKLLYLTTTNESGVFITGHRGQPYTYDAKVKNFIQWIR    421 - 490
TKSDSGEQKNMVIGGYYPYPPVPETFSKYSSSIKVESLLTAISEVRKEIEDLQYREQKRIAIQGIITAIK    491 - 560
YIPHSSATESASASETLRNANRPSTSQAARVEIQERNGKRHQDDEPVNSQYFQTTSTNLSLSNKIRILQG    561 - 630
PHANPVAVPQPGASVQTKGIKPGMPSIFNRRANINANLQGKARKTISDRWESQLWREKKFGLIDHLHYSR    631 - 700
VYPESIPRKFMFEHRKFLSDQYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLP    701 - 770
MYCPEDIRTSQIDTLLTSMNYSCAYPQDTTGNDRLPGPRAVAGDIIKAATELDRVHIVGILDICNLGNNK    771 - 840
VEVYLHKIYSPENTS                                                           841 - 855
//

Text Mined References (12)

PMID Year Title