Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.09
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.03948362211884E-19
lung carcinoma 2844 4.50021188761547E-18
lung adenocarcinoma 2714 4.62157388725152E-15
Breast cancer 3099 5.5125175032503E-12
posterior fossa group B ependymoma 1530 8.1262650475242E-10
malignant mesothelioma 3163 1.10143571462158E-8
chronic lymphocytic leukemia 244 5.13729661593066E-8
pilocytic astrocytoma 3086 1.35844314125959E-5
interstitial cystitis 2299 1.45818061456718E-5
lung cancer 4473 1.67138331018513E-5
tuberculosis 1563 4.05839255817394E-5
Pick disease 1893 3.88353808281026E-4
medulloblastoma, large-cell 6234 0.00107148158975235
psoriasis 6685 0.00263903451131921
chronic rhinosinusitis 512 0.00907169224624592
acute myeloid leukemia 785 0.011711715650864
atypical teratoid / rhabdoid tumor 4369 0.036650579299082
cystic fibrosis and chronic rhinosinusitis 213 0.0391523363225246

Expression

  Differential Expression (18)

Disease log2 FC p
chronic lymphocytic leukemia -1.671 0.000
malignant mesothelioma -3.000 0.000
psoriasis -1.100 0.003
posterior fossa group B ependymoma 2.400 0.000
atypical teratoid / rhabdoid tumor -1.200 0.037
medulloblastoma, large-cell -2.100 0.001
tuberculosis -1.100 0.000
lung cancer -1.700 0.000
interstitial cystitis -2.400 0.000
lung adenocarcinoma -1.100 0.000
pilocytic astrocytoma 1.700 0.000
lung carcinoma 1.700 0.000
Pick disease -1.100 0.000
Breast cancer -2.300 0.000
acute myeloid leukemia -1.200 0.012
ovarian cancer -3.300 0.000
chronic rhinosinusitis -1.414 0.009
cystic fibrosis and chronic rhinosinusit... -1.338 0.039

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MSGESGQPEAGPSHAGLDWPNPERNRAGVPGGVIRRAGSQGPRSWIQKVLEQIMDSPRQCVTPSEVVPVT      1 - 70
VLAVQRYLLEDEPRDTVPKPPLYCYDVTISDGVYQEKCYLDPSLNSLVYQNILKVGIQMRISRVSCLYNE     71 - 140
KRIGQGILCIDNVHCGETSDSISLETPFRNRAHQEKPERPLRGGKSHYLALWNNEDPYGDIWLTDKQPEE    141 - 210
HNFSDTKIISLSHLEMTWTNRRNFPALLVRILHKSKLRYYGKPDKKMIEPYQTFLEVADSSGTVSVIMWN    211 - 280
ALCPEWYKSLRVGLVLLLQDYSVKKSYPFRIQPVPVDPQIKLISTMEICLNLRDPPTNIIIIPEKQVKPE    281 - 350
WRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVEL    351 - 420
FSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKLLYLTTTNESGVFITGHRGQPYTYDAKVKNFIQWIR    421 - 490
TKSDSGEQKNMVIGGYYPYPPVPETFSKYSSSIKVESLLTAISEVRKEIEDLQYREQKRIAIQGIITAIK    491 - 560
YIPHSSATESASASETLRNANRPSTSQAARVEIQERNGKRHQDDEPVNSQYFQTTSTNLSLSNKIRILQG    561 - 630
PHANPVAVPQPGASVQTKGIKPGMPSIFNRRANINANLQGKARKTISDRWESQLWREKKFGLIDHLHYSR    631 - 700
VYPESIPRKFMFEHRKFLSDQYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLP    701 - 770
MYCPEDIRTSQIDTLLTSMNYSCAYPQDTTGNDRLPGPRAVAGDIIKAATELDRVHIVGILDICNLGNNK    771 - 840
VEVYLHKIYSPENTS                                                           841 - 855
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.