Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MRRSSGFGGQKGQGPSCSFTGCWCCRGDDVAESDDSPFAQCGYNIQEKHLGKLHRAASRGEVSKVECILS      1 - 70
SGSADLDERDKKKRTALHLACANGHPEVVALLVDRGCQLDVFDNKNRTALLKAVQCQEEECATILLEHGA     71 - 140
DPDLPDVYGNTTLHYAIYNEDIPMTKKLLLHHANIESANKDELTPFLLAVHEQKQQMEDFLRKQKENLTA    141 - 210
VKLESIHQVMSEYKENETPRNPQNSNPEGTSNKMACLGEGAAGAKVDEIPGNPVKRLFNKPSIDDSRPMS    211 - 280
ANEDFDFDTEEKATEPANGKRQNGMGIIESAPQEHTNNENI                                 281 - 321
//

Text Mined References (5)

PMID Year Title