Property Summary

NCBI Gene PubMed Count 27
Grant Count 25
R01 Count 19
Funding $1,856,249.15
PubMed Score 62.27
PubTator Score 34.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.100 0.000
ovarian cancer 1.100 0.000

Gene RIF (17)

PMID Text
26408825 studies reveal the ALKBH2 binding interface of PCNA and indicate that both germline and somatic ALKBH2 variants could have cellular effects on ALKBH2 function in DNA repair.
25797601 It was shown for first time that DNA glycosylase ALKBH2 can repair DNA adduct 1,N2-ethenoguanine.
23972994 ABH2 knockdown impairs rDNA transcription and leads to increased single-stranded and double-stranded DNA breaks in the rDNA genes.
23279696 ALKBH2 is an upstream molecule of the oncoprotein, MUC1, and regulates cell cycle and EMT, resulting in progression of urothelial carcinomas.
23258843 Overexpression of ALKBH2 is associated with enhanced resistance to temozolomide in glioblastoma.
22659876 combination of duplex interrogation and oxidation chemistry allows ALKBH2 to detect and process diverse lesions efficiently and correctly
22079122 The non-enzymatic binding of AAG to 3,N(4)-ethenocytosine specifically blocks ALKBH2-catalyzed repair of 3,N(4)-ethenocytosine but not that of methylated ALKBH2 substrates.
21510633 X-ray absorption spectroscopy structural investigation of early intermediates in the mechanism of DNA repair by human ABH2
21155885 ABH2 is downregulated in a subset of gastric cancers, and might be involved in the molecular mechanism of gastric cancer through inhibiting the proliferation of gastric cancer cells.
20714506 This work has provided a detailed understanding of the structural features of the single-stranded DNA and double-stranded DNA preferences of ABH2 and ABH3.
More...

AA Sequence

MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT      1 - 70
VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER     71 - 140
IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR    141 - 210
VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK                       211 - 261
//

Text Mined References (31)

PMID Year Title
26408825 2015 The interaction between ALKBH2 DNA repair enzyme and PCNA is direct, mediated by the hydrophobic pocket of PCNA and perturbed in naturally-occurring ALKBH2 variants.
25797601 2015 Differential repair of etheno-DNA adducts by bacterial and human AlkB proteins.
23972994 2013 ABH2 couples regulation of ribosomal DNA transcription with DNA alkylation repair.
23279696 2013 ALKBH2, a novel AlkB homologue, contributes to human bladder cancer progression by regulating MUC1 expression.
23258843 2013 The DNA repair protein ALKBH2 mediates temozolomide resistance in human glioblastoma cells.
22659876 2012 Duplex interrogation by a direct DNA repair protein in search of base damage.
22079122 2012 Direct repair of 3,N(4)-ethenocytosine by the human ALKBH2 dioxygenase is blocked by the AAG/MPG glycosylase.
21510633 2011 X-ray absorption spectroscopy structural investigation of early intermediates in the mechanism of DNA repair by human ABH2.
21269460 2011 Initial characterization of the human central proteome.
21155885 2011 Frequent down-regulation of hABH2 in gastric cancer and its involvement in growth of cancer cells.
More...