Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.36
PubTator Score 4.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.001
medulloblastoma 1.400 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.800 0.000
lung cancer 1.100 0.001
Pick disease -1.400 0.000
progressive supranuclear palsy -1.200 0.021
ovarian cancer -1.200 0.000
dermatomyositis 1.200 0.001

Synonym

Accession Q6N069 B0QZ59 Q5VSP9 Q6P2D5 Q8N5J3 Q8N870
Symbols NARG1L

Gene

PANTHER Protein Class (2)

 GO Function (1)

Gene RIF (1)

PMID Text
19480662 hNaa16p (NARG1L) interacts with hNaa10p (hArd1) making a distinct ribosome associated human NatA N-terminal acetyltransferase complex. hNAA16 is expressed in a variety of human cell lines and specific knockdown of hNAA16 induces cell death.

AA Sequence

MPNVLLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEAYEFVR      1 - 70
KGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQIQMRDLEGYRETRYQL     71 - 140
LQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQTQQVPPNKIDYEYSELILYQNQVMREADLLQESL    141 - 210
EHIEMYEKQICDKLLVEEIKGEILLKLGRLKEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIY    211 - 280
EEISKQHPKAITPRRLPLTLVPGERFRELMDKFLRVNFSKGCPPLFTTLKSLYYNTEKVSIIQELVTNYE    281 - 350
ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAAIASTPTLIELFYMKAKIYKH    351 - 420
IGNLKEAAKWMDEAQSLDTADRFINSKCAKYMLRANMIKEAEEMCSKFTREGTSAMENLNEMQCMWFQTE    421 - 490
CISAYQRLGRYGDALKKCHEVERHFFEITDDQFDFHTYCMRKMTLRAYVDLLRLEDILRRHAFYFKAARS    491 - 560
AIEIYLKLYDNPLTNESKQQEINSENLSAKELKKMLSKQRRAQKKAKLEEERKHAERERQQKNQKKKRDE    561 - 630
EEEEASGLKEELIPEKLERVENPLEEAVKFLIPLKNLVADNIDTHLLAFEIYFRKGKFLLMLQSVKRAFA    631 - 700
INSNNPWLHECLIRFSKSVSNHSNLPDIVSKVLSQEMQKIFVKKDLESFNEDFLKRNATSLQHLLSGAKM    701 - 770
MYFLDKSRQEKAIAIATRLDETIKDKDVKTLIKVSEALLDGSFGNCSSQYEEYRMACHNLLPFTSAFLPA    771 - 840
VNEVDNPNVALNHTANYDVLANEI                                                  841 - 864
//

Text Mined References (14)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19480662 2009 A novel human NatA Nalpha-terminal acetyltransferase complex: hNaa16p-hNaa10p (hNat2-hArd1).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...