Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MATVGAPRHFCRCACFCTDNLYVARYGLHVRFRGEQQLRRDYGPILRSRGCVSAKDFQQLLAELEQEVER      1 - 70
RQRLGQESAARKALIASSYHPARPEVYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRLETVSEEKRIY     71 - 140
RVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQPLMALLYPDCG    141 - 210
GGRLDSHRAFVVKYAPGQDLELGCHYDNAELTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQ    211 - 280
GVLHRGGQLHGARPLGTGERWNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT    281 - 350
//

Text Mined References (8)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.