Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.29
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.3188899020783E-9
sonic hedgehog group medulloblastoma 1482 5.37638300870826E-8
atypical teratoid/rhabdoid tumor 1095 7.5349560936289E-8
psoriasis 6685 1.27924600894031E-7
malignant mesothelioma 3163 5.59567119646494E-6
glioblastoma 5572 1.16421853277689E-4
ovarian cancer 8492 2.05064811848208E-4
medulloblastoma, large-cell 6234 0.00316491610505817
Pick disease 1893 0.00461605110319463
progressive supranuclear palsy 674 0.0494145797272884
Disease Target Count Z-score Confidence
Dyslexia 36 4.9 2.4
Speech disorder 7 4.242 2.1
Apraxia 25 4.037 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis -1.300 0.000
osteosarcoma 3.013 0.000
sonic hedgehog group medulloblastoma 1.900 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.003
Pick disease -1.200 0.005
progressive supranuclear palsy -1.200 0.049
ovarian cancer -1.500 0.000

Synonym

Accession Q6N043 A1L495 B2RMT6 Q6MZM6 Q6N085 Q6P2R6 Q7Z6J5 Q9H0U5 Q9HCI8 Q9NXS0
Symbols SUHW4
ZNF634

Gene

  Ortholog (1)

Species Source
Macaque EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
20798984 As a first exploitation of this unique cohort, we identify three novel candidate dyslexia genes, ZNF280D and TCF12 at 15q21, and PDE7B at 6q23.3, by molecular mapping of the familial translocation with the 15q21 breakpoint.

AA Sequence

MGDNPFQPKSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAISNILNRVNPSSYS      1 - 70
RGLKNGALSRGITAAFKPTSQHYTNPTSNPVPASPINFHPESRSSDSSVIVQPFSKPGYITNSSRVVSNK     71 - 140
SSELLFDLTQDTGLSHYQGGPTLSMAGMSESSFLSKRPSTSEVNNVNPKKPKPSESVSGANSSAVLPSVK    141 - 210
SPSVTSSQAMLAKGTNTSSNQSKNGTPFPRACPKCNIHFNLLDPLKNHMKYCCPDMINNFLGLAKTEFSS    211 - 280
TVNKNTTIDSEKGKLIMLVNDFYYGKHEGDVQEEQKTHTTFKCFSCLKILKNNIRFMNHMKHHLELEKQS    281 - 350
SESWENHTTCQHCYRQFPTPFQLQCHIESTHTPHEFSTICKICELSFETEHVLLQHMKDNHKPGEMPYVC    351 - 420
QVCNYRSSSFSDVETHFRTSHENTKNLLCPFCLKVIKIATPYMHHYMKHQKKGIHRCTKCRLQFLTCKEK    421 - 490
MDHKTQHHRTFIKPKQLEGLPPGTKVTIRASVGPLQSGASPTPSISASASTLQLSPPRTKNITAKNPAKS    491 - 560
NTSKPNTVKSNASKPNTSKPNGSKSKYKPKISNMQKKQSTLASSNKKSKVNTALRNLRYRRGIHKCIECC    561 - 630
SEIKDFANHFPTYVHCSFCRYNTSCSKAYVNHMMSFHSNRPSKRFCIFKKHSENLRGITLVCLNCDFLSD    631 - 700
VSGLDNMATHLSQHKTHTCQVVMQKVSVCIPTSEHLSELKKEAPAKEQEPVSKEIARPNMAERETETSNS    701 - 770
ESKQDKAASSKEKNGCNANSFEGSSTTKSEESITVSDKENETCLADQETGSKNIVSCDSNIGADKVEKKK    771 - 840
QIQHVCQEMELKMCQSSENIILSDQIKDHNSSEARFSSKNIKDLRLASDNVSIDQFLRKRHEPESVSSDV    841 - 910
SEQGSIHLEPLTPSEVLEYEATEILQKGSGDPSAKTDEVVSDQTDDIPGGNNPSTTEATVDLEDEKERS     911 - 979
//

Text Mined References (20)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20798984 2011 A cohort of balanced reciprocal translocations associated with dyslexia: identification of two putative candidate genes at DYX1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...