Property Summary

NCBI Gene PubMed Count 173
Grant Count 115
R01 Count 74
Funding $12,927,768.04
PubMed Score 1705.08
PubTator Score 288.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q6N021 B5MDU0 Q2TB88 Q3LIB8 Q96JX5 Q9HCM6 Q9NXW0
Symbols MDS
KIAA1546

Gene

PDB

4NM6   5D9Y   5DEU  

 GO Component (1)

Gene RIF (168)

PMID Text
26984174 TET2 expression is reduced in myelodysplatic syndrome/acute myeloid leukemia patients, independently of mutational status.
26880370 inactivation of MLL3 and TET2 may play an important role in the tumorigenesis process of HTLV-I-induced acute adult T-cell leukemia.
26825711 Among 864 Dutch persons between 80 and 105.8 years of age, DNA sequence analysis of TET2 confirmed a high incidence of somatic mutations but no effect on 10-year survival.
26771811 We confirm the negative prognostic impact imparted by ASXL1 mutations and suggest a favorable impact from TET2 mutations in the absence of ASXL1 mutations.
26763362 TET2 mutation occurred in a number of ATLL patients and was likely involved in their leukemogenesis.
26711177 Here, the authors reveal the methylcytosine dioxygenases TET1 and TET2 as active regulators of CTCF-mediated alternative splicing through conversion of 5-methylcytosine to its oxidation derivatives.
26663912 BRLF1 BRLF1 BRLF1
26617797 CD34(+) cells lowering expression of TET2 may play an oncogenic role on myeloid tumor and CD3(+) T cells of myelodysplastic syndrome patients may be derived from the malignant clone.
26568194 Low levels of tet2-DMC (Differentially Methylated CpG) define a subgroup of AML that is highly curable and cannot be identified solely by genetic and cytogenetic analyses.
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
More...

AA Sequence

MEQDRTNHVEGNRLSPFLIPSPPICQTEPLATKLQNGSPLPERAHPEVNGDTKWHSFKSYYGIPCMKGSQ      1 - 70
NSRVSPDFTQESRGYSKCLQNGGIKRTVSEPSLSGLLQIKKLKQDQKANGERRNFGVSQERNPGESSQPN     71 - 140
VSDLSDKKESVSSVAQENAVKDFTSFSTHNCSGPENPELQILNEQEGKSANYHDKNIVLLKNKAVLMPNG    141 - 210
ATVSASSVEHTHGELLEKTLSQYYPDCVSIAVQKTTSHINAINSQATNELSCEITHPSHTSGQINSAQTS    211 - 280
NSELPPKPAAVVSEACDADDADNASKLAAMLNTCSFQKPEQLQQQKSVFEICPSPAENNIQGTTKLASGE    281 - 350
EFCSGSSSNLQAPGGSSERYLKQNEMNGAYFKQSSVFTKDSFSATTTPPPPSQLLLSPPPPLPQVPQLPS    351 - 420
EGKSTLNGGVLEEHHHYPNQSNTTLLREVKIEGKPEAPPSQSPNPSTHVCSPSPMLSERPQNNCVNRNDI    421 - 490
QTAGTMTVPLCSEKTRPMSEHLKHNPPIFGSSGELQDNCQQLMRNKEQEILKGRDKEQTRDLVPPTQHYL    491 - 560
KPGWIELKAPRFHQAESHLKRNEASLPSILQYQPNLSNQMTSKQYTGNSNMPGGLPRQAYTQKTTQLEHK    561 - 630
SQMYQVEMNQGQSQGTVDQHLQFQKPSHQVHFSKTDHLPKAHVQSLCGTRFHFQQRADSQTEKLMSPVLK    631 - 700
QHLNQQASETEPFSNSHLLQHKPHKQAAQTQPSQSSHLPQNQQQQQKLQIKNKEEILQTFPHPQSNNDQQ    701 - 770
REGSFFGQTKVEECFHGENQYSKSSEFETHNVQMGLEEVQNINRRNSPYSQTMKSSACKIQVSCSNNTHL    771 - 840
VSENKEQTTHPELFAGNKTQNLHHMQYFPNNVIPKQDLLHRCFQEQEQKSQQASVLQGYKNRNQDMSGQQ    841 - 910
AAQLAQQRYLIHNHANVFPVPDQGGSHTQTPPQKDTQKHAALRWHLLQKQEQQQTQQPQTESCHSQMHRP    911 - 980
IKVEPGCKPHACMHTAPPENKTWKKVTKQENPPASCDNVQQKSIIETMEQHLKQFHAKSLFDHKALTLKS    981 - 1050
QKQVKVEMSGPVTVLTRQTTAAELDSHTPALEQQTTSSEKTPTKRTAASVLNNFIESPSKLLDTPIKNLL   1051 - 1120
DTPVKTQYDFPSCRCVEQIIEKDEGPFYTHLGAGPNVAAIREIMEERFGQKGKAIRIERVIYTGKEGKSS   1121 - 1190
QGCPIAKWVVRRSSSEEKLLCLVRERAGHTCEAAVIVILILVWEGIPLSLADKLYSELTETLRKYGTLTN   1191 - 1260
RRCALNEERTCACQGLDPETCGASFSFGCSWSMYYNGCKFARSKIPRKFKLLGDDPKEEEKLESHLQNLS   1261 - 1330
TLMAPTYKKLAPDAYNNQIEYEHRAPECRLGLKEGRPFSGVTACLDFCAHAHRDLHNMQNGSTLVCTLTR   1331 - 1400
EDNREFGGKPEDEQLHVLPLYKVSDVDEFGSVEAQEEKKRSGAIQVLSSFRRKVRMLAEPVKTCRQRKLE   1401 - 1470
AKKAAAEKLSSLENSSNKNEKEKSAPSRTKQTENASQAKQLAELLRLSGPVMQQSQQPQPLQKQPPQPQQ   1471 - 1540
QQRPQQQQPHHPQTESVNSYSASGSTNPYMRRPNPVSPYPNSSHTSDIYGSTSPMNFYSTSSQAAGSYLN   1541 - 1610
SSNPMNPYPGLLNQNTQYPSYQCNGNLSVDNCSPYLGSYSPQSQPMDLYRYPSQDPLSKLSLPPIHTLYQ   1611 - 1680
PRFGNSQSFTSKYLGYGNQNMQGDGFSSCTIRPNVHHVGKLPPYPTHEMDGHFMGATSRLPPNLSNPNMD   1681 - 1750
YKNGEHHSPSHIIHNYSAAPGMFNSSLHALHLQNKENDMLSHTANGLSKMLPALNHDRTACVQGGLHKLS   1751 - 1820
DANGQEKQPLALVQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPN   1821 - 1890
RNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETS   1891 - 1960
EPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI                               1961 - 2002
//

Text Mined References (184)

PMID Year Title
26984174 2016 Low Ten-eleven-translocation 2 (TET2) transcript level is independent of TET2 mutation in patients with myeloid neoplasms.
26880370 2016 Mutation of epigenetic regulators TET2 and MLL3 in patients with HTLV-I-induced acute adult T-cell leukemia.
26825711 2016 Uncompromised 10-year survival of oldest old carrying somatic mutations in DNMT3A and TET2.
26771811 2016 Prognostic interaction between ASXL1 and TET2 mutations in chronic myelomonocytic leukemia.
26763362 2015 TET2 Mutation in Adult T-Cell Leukemia/Lymphoma.
26711177 2016 TET-catalyzed oxidation of intragenic 5-methylcytosine regulates CTCF-dependent alternative splicing.
26663912 2015 5-hydroxymethylation of the EBV genome regulates the latent to lytic switch.
26617797 2015 Down-regulation of TET2 in CD3? and CD34? cells of myelodysplastic syndromes and enhances CD34? cells proliferation.
26568194 2015 Hypomethylation of TET2 Target Genes Identifies a Curable Subset of Acute Myeloid Leukemia.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
More...