Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.71
PubTator Score 3.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.3e-25
osteosarcoma 7950 2.2e-08
ovarian cancer 8520 8.4e-06
non-small cell lung cancer 2890 7.2e-04
fibroadenoma 559 3.0e-03
invasive ductal carcinoma 2951 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Eosinophilic esophagitis 16 3.024 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
fibroadenoma 1.700 3.0e-03
invasive ductal carcinoma 1.200 1.7e-02
non-small cell lung cancer 1.200 7.2e-04
osteosarcoma 2.242 2.2e-08
ovarian cancer 1.200 8.4e-06
psoriasis -2.400 6.3e-25

Gene RIF (2)

AA Sequence

MAYYQEPSVETSIIKFKDQDFTTLRDHCLSMGRTFKDETFPAADSSIGQKLLQEKRLSNVIWKRPQDLPG      1 - 70
GPPHFILDDISRFDIQQGGAADCWFLAALGSLTQNPQYRQKILMVQSFSHQYAGIFRFRFWQCGQWVEVV     71 - 140
IDDRLPVQGDKCLFVRPRHQNQEFWPCLLEKAYAKLLGSYSDLHYGFLEDALVDLTGGVITNIHLHSSPV    141 - 210
DLVKAVKTATKAGSLITCATPSGPTDTAQAMENGLVSLHAYTVTGAEQIQYRRGWEEIISLWNPWGWGEA    211 - 280
EWRGRWSDGSQEWEETCDPRKSQLHKKREDGEFWMSCQDFQQKFIAMFICSEIPITLDHGNTLHEGWSQI    281 - 350
MFRKQVILGNTAGGPRNDAQFNFSVQEPMEGTNVVVCVTVAVTPSNLKAEDAKFPLDFQVILAGSQRFRE    351 - 420
KFPPVFFSSFRNTVQSSNNKFRRNFTMTYHLSPGNYVVVAQTRRKSAEFLLRIFLKMPDSDRHLSSHFNL    421 - 490
RMKGSPSEHGSQQSIFNRYAQQRLDIDATQLQGLLNQELLTGPPGDMFSLDECRSLVALMELKVNGRLDQ    491 - 560
EEFARLWKRLVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIFISRELLHLVTLRYSDSVGRVSFPS    561 - 630
LVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN                                   631 - 669
//

Text Mined References (11)

PMID Year Title