Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.40
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.53878121701794E-24
osteosarcoma 7933 1.75058100876327E-6
medulloblastoma, large-cell 6234 5.06006573373112E-5
cutaneous lupus erythematosus 1056 0.00253805180431108
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 0.003
osteosarcoma 1.183 0.000
medulloblastoma, large-cell 1.200 0.000
lung carcinoma 1.400 0.000

Synonym

Accession Q6MZW2 Q8TBU0 Q9UPU1
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

 MGI Term (1)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFC      1 - 70
SRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDCFLKGDTC     71 - 140
TMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLD    141 - 210
EDLLGCSPGDLLRFDDYNSDSSLTLREFYMAFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVHGDLRPPI    211 - 280
IWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQ    281 - 350
AQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVG    351 - 420
VDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEIC    421 - 490
PQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGVDPLPAKLSYDKSHDQVWVLS    491 - 560
WGDVHKSRPSLQVITEASTGQSQHLIRTPFAGVDDFFIPPTNLIINHIRFGFIFNKSDPAVHKVDLETMM    561 - 630
PLKTIGLHHHGCVPQAMAHTHLGGYFFIQCRQDSPASAARQLLVDSVTDSVLGPNGDVTGTPHTSPDGRF    631 - 700
IVSAAADSPWLHVQEITVRGEIQTLYDLQINSGISDLAFQRSFTESNQYNIYAALHTEPDLLFLELSTGK    701 - 770
VGMLKNLKEPPAGPAQPWGGTHRIMRDSGLFGQYLLTPARESLFLINGRQNTLRCEVSGIKGGTTVVWVG    771 - 840
EV                                                                        841 - 842
//

Text Mined References (12)

PMID Year Title
22384028 2012 A genome-wide linkage and association scan reveals novel loci for hypertension and blood pressure traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
15527507 2004 An enigmatic fourth runt domain gene in the fugu genome: ancestral gene loss versus accelerated evolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...