Property Summary

NCBI Gene PubMed Count 9
PubMed Score 21.37
PubTator Score 12.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -4.300 1.6e-06
astrocytic glioma -2.200 9.2e-03
Astrocytoma, Pilocytic -3.000 1.5e-06
atypical teratoid / rhabdoid tumor -5.400 3.6e-20
ependymoma -2.900 5.8e-03
glioblastoma -3.600 7.0e-10
group 3 medulloblastoma -2.900 5.1e-03
lung carcinoma 1.100 2.7e-03
medulloblastoma, large-cell -5.600 1.8e-08
non diabetic and post-ischemic heart fai... 1.100 8.2e-03
oligodendroglioma -1.700 4.0e-02
primitive neuroectodermal tumor -4.200 4.7e-07

Gene RIF (6)

AA Sequence

MSSAPNGRKKRPSRSTRSSIFQISKPPLQSGDWERRGSGSESAHKTQRALDDCKMLVQEFNTQVALYREL      1 - 70
VISIGDVSVSCPSLRAEMHKTRTKGCEMARQAHQKLAAISGPEDGEIHPEICRLYIQLQCCLEMYTTEML     71 - 140
KSICLLGSLQFHRKGKEPGGGTKSLDCKIEESAETPALEDSSSSPVDSQQHSWQVSTDIENTERDMREMK    141 - 210
NLLSKLRETMPLPLKNQDDSSLLNLTPYPLVRRRKRRFFGLCCLISS                           211 - 257
//

Text Mined References (13)

PMID Year Title