Property Summary

NCBI Gene PubMed Count 36
PubMed Score 0.00
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.086 7.0e-03
adult high grade glioma 1.300 1.4e-03
Astrocytoma, Pilocytic 1.800 2.7e-07
cystic fibrosis 1.202 7.0e-05
ependymoma 1.100 4.3e-05
esophageal adenocarcinoma 1.100 3.5e-02
gastric cancer 1.100 1.2e-02
glioblastoma 1.100 4.5e-02
hepatocellular carcinoma 1.700 4.4e-05
interstitial cystitis 2.000 3.2e-03
intraductal papillary-mucinous adenoma (... 1.400 7.4e-03
intraductal papillary-mucinous carcinoma... 1.700 8.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 2.4e-03
juvenile dermatomyositis 1.881 9.8e-15
lung cancer -2.000 7.0e-04
lung carcinoma -1.700 1.6e-13
malignant mesothelioma -1.400 1.5e-05
osteosarcoma -2.388 5.6e-04
ovarian cancer -1.400 9.5e-04
pancreatic cancer 1.100 5.4e-04
primary Sjogren syndrome 2.100 1.1e-04
psoriasis 1.200 5.3e-03
sarcoidosis 1.100 2.0e-02
subependymal giant cell astrocytoma 1.676 1.6e-02
tuberculosis -1.700 1.6e-04

Gene RIF (20)

AA Sequence

MLLRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLL      1 - 70
PSLCDSSHASSWGSGSITCAWRGGDSSSHPLVSGHILSNSPVAAVMCSSMGTHLSPFKGTLL             71 - 132
//

Text Mined References (40)

PMID Year Title