Property Summary

NCBI Gene PubMed Count 34
PubMed Score 0.00
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Gene RIF (18)

PMID Text
25369137 Evidence of a higher risk to develop pericarditis with STAT4 genotypes, and an association between HCP5 rs3099844 and anti-Ro/SSA antibodies in Italian systemic lupus erythematosus patients.
25297839 Genome-wide association analyses in 22,981 participants (2280 shingles cases) from the electronic Medical Records and Genomics Network identified a genomic region in the combined and European ancestry groups that has an age of onset effect reaching genome-wide significance region tags the non-coding gene HCP5 (HLA Complex P5).
25264125 The aim of this study was to investigate whether the HCP5, TNIP1, TNFAIP3, SPATA2 and COG6 genes were genetic risk factors for psoriasis in Chinese population.
24322967 We confirmed the association of HCP5 with the Stevens Johnsons Syndrome/Toxic Epidermal Necrolysis susceptibility in a population from Mozambique treated with nevirapine
23665287 confirms the MICA/HCP5 region as a susceptibility locus for HCV-related hepatocellular carcinoma and identifies rs2244546 in HCP5 as a novel tagging SNP
21860345 assessed whether increases in viral load set points are associated with genetic markers in CCR5, HCP5, and HLA-C genes
21510768 Haplotype analysis revealed that HLA-B*5701 and the HCP5 rs2395029(G) allele are in complete LD (r(2) = 1) in this Mexican Mestizos sample.
21084992 Observational study of gene-disease association. (HuGE Navigator)
20559009 HLA-B44 allele is prevalent in Polish patients with chronic spontaneous urticaria
20534626 Observational study of genetic testing. (HuGE Navigator)
More...

AA Sequence

MLLRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLL      1 - 70
PSLCDSSHASSWGSGSITCAWRGGDSSSHPLVSGHILSNSPVAAVMCSSMGTHLSPFKGTLL             71 - 132
//

Text Mined References (38)

PMID Year Title
25369137 2014 A multilocus genetic study in a cohort of Italian SLE patients confirms the association with STAT4 gene and describes a new association with HCP5 gene.
25297839 Genetic variation in the HLA region is associated with susceptibility to herpes zoster.
25264125 2014 Investigating the genetic association of HCP5, SPATA2, TNIP1, TNFAIP3 and COG6 with psoriasis in Chinese population.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
24322967 2014 HCP5 genetic variant (RS3099844) contributes to Nevirapine-induced Stevens Johnsons Syndrome/Toxic Epidermal Necrolysis susceptibility in a population from Mozambique.
23665287 2013 Comparative genetic analyses point to HCP5 as susceptibility locus for HCV-associated hepatocellular carcinoma.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
More...