Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.17

Knowledge Summary

Patent

No data available

Synonym

Accession Q6MZM9 A8MXP0 Q6MZR6
Symbols C4orf40

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG

AA Sequence

MKLLLWACIVCVAFARKRRFPFIGEDDNDDGHPLHPSLNIPYGIRNLPPPLYYRPVNTVPSYPGNTYTDT      1 - 70
GLPSYPWILTSPGFPYVYHIRGFPLATQLNVPPLPPRGFPFVPPSRFFSAAAAPAAPPIAAEPAAAAPLT     71 - 140
ATPVAAEPAAGAPVAAEPAAEAPVGAEPAAEAPVAAEPAAEAPVGVEPAAEEPSPAEPATAKPAAPEPHP    141 - 210
SPSLEQANQ                                                                 211 - 219
//

Text Mined References (7)

PMID Year Title
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.