Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.29

Knowledge Summary

Patent

No data available

AA Sequence

MKLLLWACIVCVAFARKRRFPFIGEDDNDDGHPLHPSLNIPYGIRNLPPPLYYRPVNTVPSYPGNTYTDT      1 - 70
GLPSYPWILTSPGFPYVYHIRGFPLATQLNVPPLPPRGFPFVPPSRFFSAAAAPAAPPIAAEPAAAAPLT     71 - 140
ATPVAAEPAAGAPVAAEPAAEAPVGAEPAAEAPVAAEPAAEAPVGVEPAAEEPSPAEPATAKPAAPEPHP    141 - 210
SPSLEQANQ                                                                 211 - 219
//

Text Mined References (7)

PMID Year Title