Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6L9T8
Symbols GCUD2

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLK      1 - 70
DIACLKCGNIVGYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVL     71 - 140
NISAEECIR                                                                 141 - 149
//

Text Mined References (2)

PMID Year Title