Property Summary

NCBI Gene PubMed Count 11
Grant Count 12
R01 Count 10
Funding $7,327,405.68
PubMed Score 30.11
PubTator Score 12.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (5)

PMID Text
26055709 PDE12 is a negative regulator of the antiviral innate immune response.
21666256 2'-phosphodiesterase is a mitochondrial protein that specifically removes poly(A) extensions from mitochondrial mRNAs both in vitro and in mitochondria of cultured cells.
21245038 2'-PDE locates to the mitochondrial matrix of human cells, and comprise an active 3'-5' exoribonuclease exhibiting a preference for oligo-adenosine RNA like canonical cytoplasmic deadenylases.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20445249 crystals of phosphodiesterase 12 belonged to space group P3(1)21 or P3(2)21, with unit-cell parameters a = b = 111.3, c = 192.4 A, and diffracted to 2.5 A resolution.

AA Sequence

MWRLPGARAALRVIRTAVEKLSRAEAGSQTAAGAMERAVVRCVPSEPKLSLSFALADGSHKNMQRDQSEP      1 - 70
LGRVLSRIATNALKGHAKAAAAKKSRKSRPNASGGAACSGPGPEPAVFCEPVVKLYYREEAVAEDVLNVD     71 - 140
AWQDGAVLQIGDVKYKVERNPPAFTELQLPRYIMAGFPVCPKLSLEFGDPASSLFRWYKEAKPGAAEPEV    141 - 210
GVPSSLSPSSPSSSWTETDVEERVYTPSNADIGLRLKLHCTPGDGQRFGHSRELESVCVVEAGPGTCTFD    211 - 280
HRHLYTKKVTEDALIRTVSYNILADTYAQTEFSRTVLYPYCAPYALELDYRQNLIQKELTGYNADVICLQ    281 - 350
EVDRAVFSDSLVPALEAFGLEGVFRIKQHEGLATFYRKSKFSLLSQHDISFYEALESDPLHKELLEKLVL    351 - 420
YPSAQEKVLQRSSVLQVSVLQSTKDSSKRICVANTHLYWHPKGGYIRLIQMAVALAHIRHVSCDLYPGIP    421 - 490
VIFCGDFNSTPSTGMYHFVINGSIPEDHEDWASNGEEERCNMSLTHFFKLKSACGEPAYTNYVGGFHGCL    491 - 560
DYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKWK                         561 - 609
//

Text Mined References (19)

PMID Year Title
26055709 2015 The Role of Phosphodiesterase 12 (PDE12) as a Negative Regulator of the Innate Immune Response and the Discovery of Antiviral Inhibitors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22285541 2012 Characterization of human phosphodiesterase 12 and identification of a novel 2'-5' oligoadenylate nuclease - The ectonucleotide pyrophosphatase/phosphodiesterase 1.
21666256 2011 PDE12 removes mitochondrial RNA poly(A) tails and controls translation in human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
21245038 2011 Human 2'-phosphodiesterase localizes to the mitochondrial matrix with a putative function in mitochondrial RNA turnover.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20445249 2010 Crystallization and preliminary X-ray crystallographic analysis of human phosphodiesterase 12.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...