Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.0011563792285989
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.441 1.7

AA Sequence

MGCCGCSGGCGSGCGGCGSGCGGCGSGCGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSS      1 - 70
CGSCGGSKGGYGSCGGSKGGCVSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCVSCGGSKGG     71 - 140
CGSCGGSKGGCVSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCCKPCCCSSG    141 - 210
CGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKPYCCQSSCCKPCCSSSGCGSSCCQSSCCNPCCSQSSCCV    211 - 280
PVCCQCKI                                                                  281 - 288
//

Text Mined References (1)

PMID Year Title
15144888 2004 Identification of two novel clusters of ultrahigh-sulfur keratin-associated protein genes on human chromosome 11.