Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q6L8H1
Symbols KRTAP5.4

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGCCGCSGGCGSGCGGCGSGCGGCGSGCGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSS      1 - 70
CGSCGGSKGGYGSCGGSKGGCVSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCVSCGGSKGG     71 - 140
CGSCGGSKGGCVSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCCKPCCCSSG    141 - 210
CGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKPYCCQSSCCKPCCSSSGCGSSCCQSSCCNPCCSQSSCCV    211 - 280
PVCCQCKI                                                                  281 - 288
//

Text Mined References (1)

PMID Year Title
15144888 2004 Identification of two novel clusters of ultrahigh-sulfur keratin-associated protein genes on human chromosome 11.