Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

AA Sequence

MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCTSCGSCGGSKGCCGSCGGSKGGC      1 - 70
GSCGGSKGGCGSCGCSQCSCCKPCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCKI                71 - 129
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144888 2004 Identification of two novel clusters of ultrahigh-sulfur keratin-associated protein genes on human chromosome 11.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.