Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.09
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.195 1.4e-04
chronic rhinosinusitis -1.227 1.9e-02
inflammatory breast cancer -1.200 4.2e-03
interstitial lung disease -1.200 4.2e-02
invasive ductal carcinoma -1.073 1.5e-03
non-small cell lung cancer -1.072 1.4e-10
osteosarcoma -1.242 6.4e-03

Gene RIF (6)

AA Sequence

MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFE      1 - 70
EFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWR     71 - 140
DYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRL    141 - 210
KVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRI    211 - 280
HERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA    281 - 350
GIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS    351 - 420
SLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR                         421 - 469
//

Text Mined References (16)

PMID Year Title