Property Summary

NCBI Gene PubMed Count 13
Grant Count 17
R01 Count 11
Funding $1,479,606.8
PubMed Score 22.64
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial lung disease -1.200 0.042
osteosarcoma -1.242 0.006
adrenocortical carcinoma -1.195 0.000
non-small cell lung cancer -1.072 0.000
invasive ductal carcinoma -1.073 0.001
non-inflammatory breast cancer -1.300 0.001
chronic rhinosinusitis -1.227 0.019

Gene RIF (6)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20583170 Observational study of gene-disease association. (HuGE Navigator)
15123600 identification of three isoforms of the mitochondrial ATP-Mg/Pi carrier APC1, APC2 and APC3; they are most likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria [APC3]
15054102 SCaMC-2, has four variants generated by alternative splicing, resulting in proteins with a common C terminus but with variations in their N-terminal halves, including the loss of one to three EF-hand motifs
12645546 may play an important role in regulating the function of hepatocytes rather than in differentiation in vivo

AA Sequence

MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFE      1 - 70
EFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWR     71 - 140
DYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRL    141 - 210
KVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRI    211 - 280
HERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA    281 - 350
GIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS    351 - 420
SLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR                         421 - 469
//

Text Mined References (16)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15123600 2004 Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution.
15054102 2004 Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...