Property Summary

NCBI Gene PubMed Count 13
PubMed Score 22.64
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.38095009867328E-10
adrenocortical carcinoma 1427 1.3859314018877E-4
non-inflammatory breast cancer 208 0.00143460851809308
invasive ductal carcinoma 2950 0.00145202503001726
osteosarcoma 7933 0.00637446316505514
chronic rhinosinusitis 512 0.0189796712166474
interstitial lung disease 292 0.0421384513980988

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial lung disease -1.200 0.042
osteosarcoma -1.242 0.006
adrenocortical carcinoma -1.195 0.000
non-small cell lung cancer -1.072 0.000
invasive ductal carcinoma -1.073 0.001
non-inflammatory breast cancer -1.300 0.001
chronic rhinosinusitis -1.227 0.019

Synonym

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (6)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20583170 Observational study of gene-disease association. (HuGE Navigator)
15123600 identification of three isoforms of the mitochondrial ATP-Mg/Pi carrier APC1, APC2 and APC3; they are most likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria [APC3]
15054102 SCaMC-2, has four variants generated by alternative splicing, resulting in proteins with a common C terminus but with variations in their N-terminal halves, including the loss of one to three EF-hand motifs
12645546 may play an important role in regulating the function of hepatocytes rather than in differentiation in vivo

AA Sequence

MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFE      1 - 70
EFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWR     71 - 140
DYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRL    141 - 210
KVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRI    211 - 280
HERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA    281 - 350
GIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS    351 - 420
SLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR                         421 - 469
//

Text Mined References (16)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15123600 2004 Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution.
15054102 2004 Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...