Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.56
PubTator Score 25.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.09302731194758E-12
lung adenocarcinoma 2714 2.51469704938207E-8
nasopharyngeal carcinoma 1056 1.04988089661429E-4
Breast cancer 3099 1.2687117669765E-4
cystic fibrosis 1670 1.43079392399109E-4
interstitial cystitis 2299 2.12461789600845E-4
Atopic dermatitis 944 0.00250746326697364
invasive ductal carcinoma 2950 0.0181409451489661
non primary Sjogren syndrome sicca 840 0.0187395907266386
spina bifida 1064 0.0333884124013974
Disease Target Count Z-score Confidence
Cervix uteri carcinoma in situ 14 4.121 2.1
Corneal dystrophy 15 3.322 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.600 0.003
non-small cell lung cancer 1.636 0.000
interstitial cystitis -2.300 0.000
cystic fibrosis -1.800 0.000
non primary Sjogren syndrome sicca 1.100 0.019
lung adenocarcinoma 2.200 0.000
nasopharyngeal carcinoma -1.200 0.000
spina bifida -2.153 0.033
Breast cancer -1.100 0.000
invasive ductal carcinoma 1.400 0.018

Synonym

Accession Q6KB66 Q6P1A5 Q7Z3Q0
Symbols KB20

Gene

  Ortholog (7)

Gene RIF (1)

PMID Text
20843789 Alternative splice variants, K80 and K80.1 distribute differently in epithelia of hair and skin.

AA Sequence

MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDV      1 - 70
KLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQ     71 - 140
EELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLE    141 - 210
SFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEE    211 - 280
QAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEA    281 - 350
ALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSK    351 - 420
APSRKKKGSKGPVIKITEMSEKYFSQESEVSE                                          421 - 452
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24465473 2014 A genome-wide association study identifies a locus on TERT for mean telomere length in Han Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20843789 2010 Against the rules: human keratin K80: two functional alternative splice variants, K80 and K80.1, with special cellular localization in a wide range of epithelia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16831889 2006 New consensus nomenclature for mammalian keratins.
More...