Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.56
PubTator Score 25.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.600 0.003
non-small cell lung cancer 1.636 0.000
interstitial cystitis -2.300 0.000
cystic fibrosis -1.800 0.000
non primary Sjogren syndrome sicca 1.100 0.019
lung adenocarcinoma 2.200 0.000
nasopharyngeal carcinoma -1.200 0.000
spina bifida -2.153 0.033
Breast cancer -1.100 0.000
invasive ductal carcinoma 1.400 0.018

Synonym

Accession Q6KB66 Q6P1A5 Q7Z3Q0
Symbols KB20

Gene

Gene RIF (1)

PMID Text
20843789 Alternative splice variants, K80 and K80.1 distribute differently in epithelia of hair and skin.

AA Sequence

MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDV      1 - 70
KLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQ     71 - 140
EELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLE    141 - 210
SFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEE    211 - 280
QAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEA    281 - 350
ALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSK    351 - 420
APSRKKKGSKGPVIKITEMSEKYFSQESEVSE                                          421 - 452
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24465473 2014 A genome-wide association study identifies a locus on TERT for mean telomere length in Han Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20843789 2010 Against the rules: human keratin K80: two functional alternative splice variants, K80 and K80.1, with special cellular localization in a wide range of epithelia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16831889 2006 New consensus nomenclature for mammalian keratins.
More...