Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.56
PubTator Score 25.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.600 2.5e-03
Breast cancer -1.100 1.3e-04
cystic fibrosis -1.100 4.9e-04
interstitial cystitis -2.000 2.9e-03
invasive ductal carcinoma 1.400 1.8e-02
lung adenocarcinoma 2.200 2.5e-08
nasopharyngeal carcinoma -1.200 1.0e-04
non primary Sjogren syndrome sicca 1.100 1.9e-02
non-small cell lung cancer 1.636 3.1e-12
spina bifida -2.153 3.3e-02

Gene RIF (1)

AA Sequence

MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDV      1 - 70
KLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQ     71 - 140
EELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLE    141 - 210
SFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEE    211 - 280
QAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEA    281 - 350
ALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSK    351 - 420
APSRKKKGSKGPVIKITEMSEKYFSQESEVSE                                          421 - 452
//

Text Mined References (13)

PMID Year Title