Property Summary

NCBI Gene PubMed Count 4
PubMed Score 33.43
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.00380148858896257
Disease Target Count Z-score Confidence
pre-eclampsia 67 3.855 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.400 0.004

AA Sequence

MPGAAEALPTVTVTLVAGAVPPASGALTAHCIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVK      1 - 70
VAYNSSGSCEIEKIVGSEIDSTGKFAFPGHREIHVLDTDYEGYAILRVSLMWRGRNFRVLKYFTRSLEDK     71 - 140
DRLGFWKFRELTADTGLYLAARPGRCAELLKEELI                                       141 - 175
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363845 2004 Molecular evolution of epididymal lipocalin genes localized on mouse chromosome 2.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.