Property Summary

NCBI Gene PubMed Count 4
PubMed Score 19.30
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 3.8e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.400 3.8e-03

AA Sequence

MPGAAEALPTVTVTLVAGAVPPASGALTAHCIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVK      1 - 70
VAYNSSGSCEIEKIVGSEIDSTGKFAFPGHREIHVLDTDYEGYAILRVSLMWRGRNFRVLKYFTRSLEDK     71 - 140
DRLGFWKFRELTADTGLYLAARPGRCAELLKEELI                                       141 - 175
//

Text Mined References (5)

PMID Year Title