Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.46
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pituitary cancer 1972 3.5e-06
Disease Target Count Z-score Confidence
Keratoconus 113 3.83 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.300 3.5e-06

AA Sequence

MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFEL      1 - 70
SDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSR     71 - 140
LAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGWSPQASVC                      141 - 192
//

Text Mined References (4)

PMID Year Title