Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.46
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Keratoconus 47 3.845 1.9
pituitary cancer 1,972

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.300 0.000

AA Sequence

MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFEL      1 - 70
SDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSR     71 - 140
LAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGWSPQASVC                      141 - 192
//

Text Mined References (4)

PMID Year Title
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
15363845 2004 Molecular evolution of epididymal lipocalin genes localized on mouse chromosome 2.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.